Gene/Proteome Database (LMPD)

LMPD ID
LMP007868
Gene ID
177320
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein ELO-5
Gene Symbol
elo-5
Synonyms
CELE_F41H10.7
Alternate Names
Protein ELO-5
Chromosome
IV
EC Number
2.3.1.199

Proteins

Protein ELO-5
Refseq ID NP_500793
Protein GI 17540336
UniProt ID Q20300
mRNA ID NM_068392
Length 286
RefSeq Status REVIEWED
MSSDDRGTRTFKMMDQILGTNFTYEGAKEVARGLEGFSAKLAVGYIATIFGLKYYMKDRKAFDLSTPLNIWNGILSTFSLLGFLFTFPTLLSVIRKDGFSHTYSHVSELYTDSTSGYWIFLWVISKIPELLDTVFIVLRKRPLIFMHWYHHALTGYYALVCYHEDAVHMVWVVWMNYIIHAFMYGYYLLKSLKVPIPPSVAQAITTSQMVQFAVAIFAQVHVSYKHYVEGVEGLAYSFRGTAIGFFMLTTYFYLWIQFYKEHYLKNGGKKYNLAKDQAKTQTKKAN

Gene Information

Entrez Gene ID
177320
Gene Name
Protein ELO-5
Gene Symbol
elo-5
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process

REACTOME Pathway Links

REACTOME Pathway ID Description
5653424 Activation of gene expression by SREBF (SREBP)
5652674 Fatty Acyl-CoA Biosynthesis
5653425 Regulation of cholesterol biosynthesis by SREBP (SREBF)
5652683 Synthesis of very long-chain fatty acyl-CoAs

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
Protein ELO-5
Protein Entry
ELO5_CAEEL
UniProt ID
Q20300
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). {ECO:0000269|PubMed:15340492}.
Disruption Phenotype Loss of function induces an egg-laying defect from the second day of adulthood with progeny arrested at the larval stage L1. The small larvae maintain morphological integrity and survive for up to 3 to 4 days. Animals had reduced levels of isoheptadecanoate (C17iso) and isopentadecanoate (C15iso). The phenotype could be fully suppressed by feeding with C17iso and partially suppressed by feeding with C15iso. {ECO:0000269|PubMed:15340492}.
Function Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs) and monomethyl branched-chain fatty acids (mmBCFAs). Required for the formation of isopentadecanoate (C15iso) and isoheptadecanoate (C17iso). {ECO:0000269|PubMed:15340492}.
Pathway Lipid metabolism; fatty acid biosynthesis. {ECO:0000269|PubMed:15340492}.
Similarity Belongs to the ELO family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity Expressed in the gut and unidentified head cells. {ECO:0000269|PubMed:15340492}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007868 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17540336 RefSeq NP_500793 286 Protein ELO-5

Identical Sequences to LMP007868 proteins

Reference Database Accession Length Protein Name
GI:17540336 EMBL CCD71100.1 286 Protein ELO-5, isoform a [Caenorhabditis elegans]
GI:17540336 SwissProt Q20300.1 286 RecName: Full=Elongation of very long chain fatty acids protein 5; AltName: Full=3-keto acyl-CoA synthase elo-5; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 5 [Caenorhabditis elegans]

Related Sequences to LMP007868 proteins

Reference Database Accession Length Protein Name
GI:17540336 GenBank AAN18892.1 278 Sequence 11 from patent US 6403349
GI:17540336 GenBank AAS29203.1 278 Sequence 18 from patent US 6677145
GI:17540336 GenBank ABA13311.1 278 Sequence 17 from patent US 6913916
GI:17540336 GenBank ABH98571.1 278 Sequence 15 from patent US 7070970
GI:17540336 GenBank ACE40425.1 278 Sequence 18 from patent US 7375205
GI:17540336 GenBank AEJ72078.1 278 Sequence 18 from patent US 7968692