Gene/Proteome Database (LMPD)

LMPD ID
LMP007866
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein PDHB-1
Gene Symbol
Synonyms
CELE_C04C3.3
Chromosome
IV

Proteins

Protein PDHB-1
Refseq ID NP_500340
Protein GI 17538422
UniProt ID O44451
mRNA ID NM_067939
Length 352
RefSeq Status REVIEWED
MALRKCGNLFVARLAGTSTRAASTMTVRDALNQAMDEEIKRDDRVFLMGEEVAQYDGAYKISKGLWKKHGDKRVVDTPITEMGFAGIAVGAAFAGLRPICEFMTFNFSMQAIDQIINSAAKTYYMSAGRVPVPIVFRGPNGAAAGVAAQHSQDFSAWYAHCPGLKVVCPYSAEDAKGLLKAAIRDDNPVVFLENEILYGQSFPVGDEVLSDDFVVPIGKAKIERAGDHVTIVSYSRGVEFSLEAAKQLEAIGVSAEVINLRSLRPFDFESIRQSVHKTHHLVSVETGWPFAGIGSEIAAQVMESDVFDQLDAPLLRVTGVDVPMPYTQTLEAAALPTAEHVVKAVKKSLNIA

Gene Information

Entrez Gene ID
Gene Name
Protein PDHB-1
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IDA:WormBase C mitochondrion
GO:0004739 IEA:UniProtKB-EC F pyruvate dehydrogenase (acetyl-transferring) activity
GO:0006086 IEA:InterPro P acetyl-CoA biosynthetic process from pyruvate
GO:0006096 IEA:UniProtKB-KW P glycolytic process

Domain Information

InterPro Annotations

Accession Description
IPR027110 Pyruvate dehydrogenase E1 component subunit beta
IPR029061 Thiamin diphosphate-binding fold
IPR005476 Transketolase, C-terminal
IPR009014 Transketolase, C-terminal/Pyruvate-ferredoxin oxidoreductase, domain II
IPR005475 Transketolase-like, pyrimidine-binding domain

UniProt Annotations

Entry Information

Gene Name
Protein PDHB-1
Protein Entry
O44451_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity Pyruvate + [dihydrolipoyllysine-residue acetyltransferase] lipoyllysine = [dihydrolipoyllysine-residue acetyltransferase] S-acetyldihydrolipoyllysine + CO(2).
Cofactor Name=thiamine diphosphate; Xref=ChEBI:CHEBI:58937; Evidence= ;
Function The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity).
Subcellular Location Mitochondrion matrix .
Subunit Tetramer of 2 alpha and 2 beta subunits.

Identical and Related Proteins

Unique RefSeq proteins for LMP007866 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17538422 RefSeq NP_500340 352 Protein PDHB-1

Identical Sequences to LMP007866 proteins

Reference Database Accession Length Protein Name
GI:17538422 EMBL CCD62196.1 352 Protein PDHB-1 [Caenorhabditis elegans]
GI:17538422 SwissProt O44451.2 352 RecName: Full=Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; Short=PDHE1-B; Flags: Precursor [Caenorhabditis elegans]

Related Sequences to LMP007866 proteins

Reference Database Accession Length Protein Name
GI:17538422 EMBL CAP37975.1 352 Protein CBR-PDHB-1 [Caenorhabditis briggsae]
GI:17538422 GenBank ABZ32020.1 366 Sequence 5958 from patent US 7314974
GI:17538422 GenBank EFO95640.1 352 hypothetical protein CRE_13110 [Caenorhabditis remanei]
GI:17538422 GenBank EGT50619.1 352 hypothetical protein CAEBREN_23122 [Caenorhabditis brenneri]
GI:17538422 RefSeq XP_002634731.1 352 Hypothetical protein CBG21051 [Caenorhabditis briggsae]
GI:17538422 RefSeq XP_003093065.1 352 hypothetical protein CRE_13110 [Caenorhabditis remanei]