Gene/Proteome Database (LMPD)
Proteins
| Protein COQ-5 | |
|---|---|
| Refseq ID | NP_498704 |
| Protein GI | 17557039 |
| UniProt ID | P34666 |
| mRNA ID | NM_066303 |
| Length | 285 |
| RefSeq Status | REVIEWED |
| MKGATNLFKSMRKPTNVGNFRQFSVNQVNSDNKRSEPGKKTHFGFTDVDEAEKEQKVHHVFANVAKKYDLMNDAMSMGVHRLWKDYYVGGLQVPYNAKCLDMAGGTGDIAFRILRHSPTAKVTVSDINQPMLDVGKKRAEKERDIQPSRAEWVCANAEQMPFESNTYDLFTMSFGIRNCTHPEKVVREAFRVLKPGGQLAILEFSEVNSALKPIYDAYSFNVIPVLGEILASDRASYQYLVESIRKFPNQDEFARIIREEGFSNVRYENLTFGVCSIHKGMKPRK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
| GO:0008168 | IEA:UniProtKB-KW | F | methyltransferase activity |
| GO:0006744 | IMP:WormBase | P | ubiquinone biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| cel01100 | Metabolic pathways |
| cel00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
| cel_M00128 | Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5653474 | Ubiquinol biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | S-adenosyl-L-methionine + 2-methoxy-6-all- trans-polyprenyl-1,4-benzoquinol = S-adenosyl-L-homocysteine + 6- methoxy-3-methyl-2-all-trans-polyprenyl-1,4-benzoquinol. |
| Function | Methyltransferase required for the conversion of 2- polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3- methyl-6-methoxy-1,4-benzoquinol (DMQH2). {ECO:0000269|PubMed:14695939}. |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
| Similarity | Belongs to the class I-like SAM-binding methyltransferase superfamily. UbiE family. {ECO:0000305}. |
| Subcellular Location | Mitochondrion {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007861 (as displayed in Record Overview)
Identical Sequences to LMP007861 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17557039 | EMBL | CCD62554.1 | 285 | Protein COQ-5 [Caenorhabditis elegans] |
| GI:17557039 | SwissProt | P34666.2 | 285 | RecName: Full=2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial; AltName: Full=Ubiquinone biosynthesis methyltransferase COQ5; Flags: Precursor [Caenorhabditis elegans] |
Related Sequences to LMP007861 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17557039 | EMBL | CAP31260.2 | 270 | Protein CBR-COQ-5 [Caenorhabditis briggsae] |
| GI:17557039 | GenBank | EFP04262.1 | 285 | CRE-COQ-5 protein [Caenorhabditis remanei] |
| GI:17557039 | GenBank | EGT56690.1 | 252 | hypothetical protein CAEBREN_25779 [Caenorhabditis brenneri] |
| GI:17557039 | GenBank | EYC37719.1 | 282 | hypothetical protein Y032_0770g2216 [Ancylostoma ceylanicum] |
| GI:17557039 | RefSeq | XP_002642671.1 | 281 | C. briggsae CBR-COQ-5 protein [Caenorhabditis briggsae] |
| GI:17557039 | RefSeq | XP_003103204.1 | 285 | CRE-COQ-5 protein [Caenorhabditis remanei] |