Gene/Proteome Database (LMPD)

LMPD ID
LMP007859
Gene ID
175729
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein CLK-1
Gene Symbol
clk-1
Synonyms
CELE_ZC395.2
Alternate Names
Protein CLK-1
Chromosome
III

Proteins

Protein CLK-1
Refseq ID NP_498128
Protein GI 17552756
UniProt ID P48376
mRNA ID NM_065727
Length 187
RefSeq Status REVIEWED
MFRVITRGAHTAASRQALIEKIIRVDHAGELGADRIYAGQLAVLQGSSVGSVIKKMWDEEKEHLDTMERLAAKHNVPHTVFSPVFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYNDQLKELLADDPETHKELLKILTRLRDEELHHHDTGVEHDGMKAPAYSALKWIIQTGCKGAIAIAEKI

Gene Information

Entrez Gene ID
175729
Gene Name
Protein CLK-1
Gene Symbol
clk-1
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IDA:WormBase C mitochondrion
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0000975 IDA:WormBase F regulatory region DNA binding
GO:0030534 IMP:WormBase P adult behavior
GO:0045333 TAS:WormBase P cellular respiration
GO:0008340 IMP:WormBase P determination of adult lifespan
GO:0006119 IMP:WormBase P oxidative phosphorylation
GO:0048520 IMP:WormBase P positive regulation of behavior
GO:0051094 IMP:WormBase P positive regulation of developmental process
GO:0040010 IMP:WormBase P positive regulation of growth rate
GO:0000003 IMP:WormBase P reproduction
GO:0042493 IMP:WormBase P response to drug
GO:0006744 IDA:WormBase P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
cel01100 Metabolic pathways
cel00130 Ubiquinone and other terpenoid-quinone biosynthesis
cel_M00128 Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone

REACTOME Pathway Links

REACTOME Pathway ID Description
5653474 Ubiquinol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR009078 Ferritin-like superfamily
IPR012347 Ferritin-related
IPR011566 Ubiquinone biosynthesis protein Coq7

UniProt Annotations

Entry Information

Gene Name
Protein CLK-1
Protein Entry
COQ7_CAEEL
UniProt ID
P48376
Species
C. elegans

Comments

Comment Type Description
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; Note=Binds 2 iron ions per subunit. {ECO:0000250};
Disruption Phenotype Worms show deregulation timing of a wide range of physiological processes. This leads to an average lengthening of the worm's early cell cycles, the embryonic and postembryonic development, and the period of rhythmic adult behaviors. {ECO:0000269|PubMed:9020081}.
Function Plays a role in biological timing and in longevity.
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Similarity Belongs to the COQ7 family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007859 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17552756 RefSeq NP_498128 187 Protein CLK-1

Identical Sequences to LMP007859 proteins

Reference Database Accession Length Protein Name
GI:17552756 EMBL CCD66658.1 187 Protein CLK-1 [Caenorhabditis elegans]
GI:17552756 GenBank ABL29744.1 187 Sequence 11 from patent US 7132274
GI:17552756 SwissProt P48376.1 187 RecName: Full=Ubiquinone biosynthesis protein COQ7 homolog; AltName: Full=Clock abnormal protein 1; Short=Protein clk-1 [Caenorhabditis elegans]

Related Sequences to LMP007859 proteins

Reference Database Accession Length Protein Name
GI:17552756 EMBL CAP38030.2 217 Protein CBR-CLK-1 [Caenorhabditis briggsae]
GI:17552756 EMBL CDJ86197.1 187 Ubiquinone biosynthesis protein COQ7 domain containing protein [Haemonchus contortus]
GI:17552756 GenBank ADY48710.1 187 Ubiquinone biosynthesis protein COQ7 [Ascaris suum]
GI:17552756 GenBank EGT45770.1 187 CBN-CLK-1 protein [Caenorhabditis brenneri]
GI:17552756 GenBank ERG86418.1 210 ubiquinone biosynthesis protein coq7-like protein [Ascaris suum]
GI:17552756 RefSeq XP_002642795.1 188 C. briggsae CBR-CLK-1 protein [Caenorhabditis briggsae]