Gene/Proteome Database (LMPD)
Proteins
| Protein F35C8.5 | |
|---|---|
| Refseq ID | NP_508912 |
| Protein GI | 17567475 |
| UniProt ID | Q20027 |
| mRNA ID | NM_076511 |
| Length | 300 |
| MLDLYPVQNLTVDQLEYEKNTRFLQPAWDWIKNGNEHILSSPLFPPFYALSIDYTWVAVFTFIDVFLCNVPFFKDAKIQKDRKVTWDLIKKSLKLQGWNQLLWIYPMALVQLIWVPDTELPILAPTVFEMLSQLAIFFLAFDFTYFWFHYINHKVKWLYRWCHSVHHMYSSPFAASAQHLHPFELFFVGTFITTIPWIFPTHCLTYWIWFFIAQSVSYEVHIGYDFPFALHRIFWFYSGAPAHDMHHLRPLTCFQPWFNYLDRLMGYHITYADLKKMTEAKFKKFGLYSAEDEKGLIKIN | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0016126 | IEA:UniProtKB-KW | P | sterol biosynthetic process |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence= ; |
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Function | Probable sterol desaturase |
| Function | Probable sterol desaturase. {ECO:0000250}. |
| Similarity | Belongs to the sterol desaturase family |
| Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007818 (as displayed in Record Overview)
Identical Sequences to LMP007818 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007818 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|