Gene/Proteome Database (LMPD)
Proteins
| Protein FAT-1 | |
|---|---|
| Refseq ID | NP_001023560 |
| Protein GI | 71999459 |
| UniProt ID | Q9NEQ0 |
| mRNA ID | NM_001028389 |
| Length | 402 |
| RefSeq Status | REVIEWED |
| MVAHSSEGLSATAPVTGGDVLVDARASLEEKEAPRDVNANTKQATTEEPRIQLPTVDAFRRAIPAHCFERDLVKSIRYLVQDFAALTILYFALPAFEYFGLFGYLVWNIFMGVFGFALFVVGHDCLHGSFSDNQNLNDFIGHIAFSPLFSPYFPWQKSHKLHHAFTNHIDKDHGHVWIQDKDWEAMPSWKRWFNPIPFSGWLKWFPVYTLFGFCDGSHFWPYSSLFVRNSERVQCVISGICCCVCAYIALTIAGSYSNWFWYYWVPLSFFGLMLVIVTYLQHVDDVAEVYEADEWSFVRGQTQTIDRYYGLGLDTTMHHITDGHVAHHFFNKIPHYHLIEATEGVKKVLEPLSDTQYGYKSQVNYDFFARFLWFNYKLDYLVHKTAGIMQFRTTLEEKAKAK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0042389 | IMP:WormBase | F | omega-3 fatty acid desaturase activity |
| GO:0006636 | IMP:WormBase | P | unsaturated fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005804 | Fatty acid desaturase, type 1 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Omega-3 fatty acid desaturase that acts on a range of substrates. Catalyzes the desaturation of linolenic acid (18:2n- 6), dihomo-gamma-linoleic acid (DHGLA) (20:3n-6), and arachidonic acid (20:4n-6), to generate gamma linolenic acid (18:3n-3), eicosatetraenoic acid (20:4n-3) and eicosapentaenoic acid (20:5n- 3) respectively. Although the enzyme has been suggested to act on glycerolipids, the precise nature of the fatty acid substrate is unknown. {ECO:0000269|PubMed:11972048, ECO:0000269|PubMed:14765186, ECO:0000269|PubMed:9037020}. |
| Pathway | Lipid metabolism; polyunsaturated fatty acid biosynthesis. {ECO:0000269|PubMed:11972048, ECO:0000269|PubMed:14765186, ECO:0000269|PubMed:9037020}. |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007805 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 71999459 | RefSeq | NP_001023560 | 402 | Protein FAT-1 |
Identical Sequences to LMP007805 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71999459 | EMBL | CAC44309.1 | 402 | Protein FAT-1 [Caenorhabditis elegans] |
| GI:71999459 | GenBank | ADR85394.1 | 402 | Sequence 69 from patent US 7736884 |
| GI:71999459 | SwissProt | Q9NEQ0.1 | 402 | RecName: Full=Omega-3 fatty acid desaturase fat-1; AltName: Full=Fatty acid desaturase 1 [Caenorhabditis elegans] |
Related Sequences to LMP007805 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71999459 | GenBank | AAA67369.1 | 402 | fatty acid desaturase [Caenorhabditis elegans] |
| GI:71999459 | GenBank | AAE60611.1 | 402 | Sequence 2 from patent US 6194167 |
| GI:71999459 | GenBank | AAN93253.1 | 402 | Sequence 2 from patent US 6459018 |
| GI:71999459 | GenBank | AAY69963.1 | 402 | Sequence 2 from patent US 6884921 |
| GI:71999459 | GenBank | ABE21477.1 | 402 | Sequence 30 from patent US 7001772 |
| GI:71999459 | GenBank | AFO18571.1 | 402 | Sequence 30 from patent US 8206984 |