Gene/Proteome Database (LMPD)

LMPD ID
LMP007779
Gene ID
945673
Species
Escherichia coli K-12 (E. coli)
Gene Name
lipoprotein-releasing system transmembrane protein
Gene Symbol
lolC
Synonyms
ECK1102; JW5161; ycfU
Summary
LolC is a membrane component of the LolCDE lipoprotein export ABC transporter. [More information is available at EcoCyc: G6573].
Orthologs
View orthologs and multiple alignments for lolC

Proteins

lipoprotein-releasing system transmembrane protein [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415634
Protein GI 16129079
UniProt ID P0ADC3
Length 399
RefSeq Status REVIEWED
MYQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNILGLMPQAILSSEHGSLNPQQLPETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPAQKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQIRVMVPSASQFTPMGRIPSQRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKLPEGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAILQTQGLTPRQIMMVFMVQGASAGIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAIEPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALRYE

Gene Information

Entrez Gene ID
945673
Gene Name
lipoprotein-releasing system transmembrane protein
Gene Symbol
lolC
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005887 IDA:EcoCyc C integral component of plasma membrane
GO:0043234 IDA:EcoCyc C protein complex
GO:0042954 IDA:EcoCyc F lipoprotein transporter activity
GO:0042953 IDA:EcoCyc P lipoprotein transport

KEGG Pathway Links

KEGG Pathway ID Description
eco02010 ABC transporters
ko02010 ABC transporters
M00255 Lipoprotein-releasing system
eco_M00255 Lipoprotein-releasing system

Domain Information

InterPro Annotations

Accession Description
IPR011925 LolCE_TM
IPR025857 MacB_PCD
IPR003838 Permease_FtsX-like

UniProt Annotations

Entry Information

Gene Name
lipoprotein-releasing system transmembrane protein
Protein Entry
LOLC_ECOLI
UniProt ID
P0ADC3
Species
E. coli

Comments

Comment Type Description
Function Part of an ATP-dependent transport system LolCDE responsible for the release of lipoproteins targeted to the outer membrane from the inner membrane. Such a release is dependent of the sorting-signal (absence of an Asp at position 2 of the mature lipoprotein) and of LolA.
Similarity Belongs to the ABC-4 integral membrane protein family. LolC/E subfamily. {ECO:0000305}.
Subcellular Location Cell inner membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP007779 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16129079 RefSeq NP_415634 399 lipoprotein-releasing system transmembrane protein [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007779 proteins

Reference Database Accession Length Protein Name
GI:16129079 GenBank KHI89621.1 399 outer membrane-specific lipoprotein transporter subunit LolC [Escherichia coli]
GI:16129079 GenBank KHI96610.1 399 outer membrane-specific lipoprotein transporter subunit LolC [Escherichia coli]
GI:16129079 GenBank KHJ02988.1 399 outer membrane-specific lipoprotein transporter subunit LolC [Escherichia coli]
GI:16129079 GenBank KHJ22746.1 399 outer membrane-specific lipoprotein transporter subunit LolC [Escherichia coli]
GI:16129079 GenBank KHJ27513.1 399 outer membrane-specific lipoprotein transporter subunit LolC [Escherichia coli]
GI:16129079 gnl IGS 399 lipoprotein-releasing system transmembrane protein [Escherichia coli ER2796]

Related Sequences to LMP007779 proteins

Reference Database Accession Length Protein Name
GI:16129079 GenBank EEH84367.1 436 lipoprotein-releasing system transmembrane protein LolC [Escherichia sp. 3_2_53FAA]
GI:16129079 GenBank EGI41640.1 436 lipoprotein-releasing system transmembrane protein LolC [Escherichia coli TA280]
GI:16129079 gnl vmpmisu 434 ABC transporter integral membrane subunit [Escherichia coli APEC O1]
GI:16129079 gnl REF_vmpmisu 434 outer membrane-specific lipoprotein transporter subunit LolC [Escherichia coli APEC O1]
GI:16129079 RefSeq WP_001316277.1 436 transporter [Escherichia coli]
GI:16129079 RefSeq WP_011703524.1 434 transporter [Escherichia coli]