Gene/Proteome Database (LMPD)

LMPD ID
LMP007768
Gene ID
944888
Species
Escherichia coli K-12 (E. coli)
Gene Name
(3R)-hydroxymyristol acyl carrier protein dehydratase
Gene Symbol
fabZ
Synonyms
ECK0179; JW0175; sabA; sefA; sfhC; yaeA
Summary
Binds TrxA (Kumar, 2004). [More information is available at EcoGene: EG11284]. Certain mutations in fabZ have been found as suppressor mutations; its sabA1 allele changes the suppression of the OmpF315 phenotype by asmB1, and increased fabZ expression suppresses OmpF315 itself . [More information is available at EcoCyc: EG11284].
Orthologs
View orthologs and multiple alignments for fabZ

Proteins

(3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_414722
Protein GI 16128173
UniProt ID P0A6Q6
Length 151
RefSeq Status REVIEWED
MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA

Gene Information

Entrez Gene ID
944888
Gene Name
(3R)-hydroxymyristol acyl carrier protein dehydratase
Gene Symbol
fabZ
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-HAMAP C cytoplasm
GO:0008693 IDA:EcoCyc F 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase activity
GO:0047451 IDA:EcoCyc F 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity
GO:0042802 IDA:EcoCyc F identical protein binding
GO:0006633 IDA:EcoCyc P fatty acid biosynthetic process
GO:0009245 IEA:UniProtKB-HAMAP P lipid A biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco00780 Biotin metabolism
ko00780 Biotin metabolism
eco00061 Fatty acid biosynthesis
ko00061 Fatty acid biosynthesis
M00083 Fatty acid biosynthesis, elongation
eco_M00083 Fatty acid biosynthesis, elongation
eco01212 Fatty acid metabolism
ko01212 Fatty acid metabolism
eco01100 Metabolic pathways
M00572 Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
eco_M00572 Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6519 8-amino-7-oxononanoate biosynthesis I
PWY-6519 8-amino-7-oxononanoate biosynthesis I
BIOTIN-BIOSYNTHESIS-PWY biotin biosynthesis I
BIOTIN-BIOSYNTHESIS-PWY biotin biosynthesis I
PWY0-862 cis-dodecenoyl biosynthesis
PWY0-862 cis-dodecenoyl biosynthesis
PWY0-862 cis-dodecenoyl biosynthesis
FASYN-ELONG-PWY fatty acid elongation -- saturated
FASYN-ELONG-PWY fatty acid elongation -- saturated
FASYN-ELONG-PWY fatty acid elongation -- saturated
PWY-6282 palmitoleate biosynthesis I
PWY-6282 palmitoleate biosynthesis I
PWY0-881 superpathway of fatty acid biosynthesis I (E. coli)
PWY0-881 superpathway of fatty acid biosynthesis I (E. coli)
PWY-6285 superpathway of fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)

Domain Information

InterPro Annotations

Accession Description
IPR013114 FabA_FabZ
IPR010084 FabZ
IPR029069 HotDog domain

UniProt Annotations

Entry Information

Gene Name
(3R)-hydroxymyristol acyl carrier protein dehydratase
Protein Entry
FABZ_ECOLI
UniProt ID
P0A6Q6
Species
E. coli

Comments

Comment Type Description
Catalytic Activity A (3R)-3-hydroxyacyl-[acyl-carrier protein] = a trans-2-enoyl-[acyl-carrier protein] + H(2)O. {ECO:0000269|PubMed:8910376}.
Function Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs. {ECO:0000269|PubMed:7806516, ECO:0000269|PubMed:8910376}.
Ptm The N-terminus is blocked.
Similarity Belongs to the thioester dehydratase family. FabZ subfamily. {ECO:0000305}.
Subcellular Location Cytoplasm.
Subunit Oligomer.

Identical and Related Proteins

Unique RefSeq proteins for LMP007768 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16128173 RefSeq NP_414722 151 (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007768 proteins

Reference Database Accession Length Protein Name
GI:16128173 GenBank KHJ05943.1 151 hydroxymyristoyl-ACP dehydratase [Escherichia coli]
GI:16128173 GenBank KHJ07581.1 151 hydroxymyristoyl-ACP dehydratase [Escherichia coli]
GI:16128173 GenBank KHJ15473.1 151 hydroxymyristoyl-ACP dehydratase [Escherichia coli]
GI:16128173 GenBank KHJ22937.1 151 hydroxymyristoyl-ACP dehydratase [Escherichia coli]
GI:16128173 GenBank KHJ22995.1 151 hydroxymyristoyl-ACP dehydratase [Escherichia coli]
GI:16128173 gnl IGS 151 (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia coli ER2796]

Related Sequences to LMP007768 proteins

Reference Database Accession Length Protein Name
GI:16128173 EMBL CDN80567.1 182 (3R)-hydroxymyristol acyl carrier protein dehydratase [Escherichia coli O25b:H4-ST131 str. EC958]
GI:16128173 GenBank EFE60732.1 182 3R-hydroxymyristoyl ACP dehydrase [Escherichia coli B088]
GI:16128173 GenBank ERF93570.1 153 hydroxymyristoyl-ACP dehydratase [Escherichia coli O104:H21 str. CFSAN002237]
GI:16128173 gnl REF_ncbi 182 (3R)-hydroxymyristoyl-ACP dehydratase [Escherichia coli UTI89]
GI:16128173 RefSeq WP_000457439.1 182 MULTISPECIES: hydroxymyristoyl-ACP dehydratase [Enterobacteriaceae]
GI:16128173 RefSeq WP_021293011.1 153 hydroxymyristoyl-ACP dehydratase [Escherichia coli]