Gene/Proteome Database (LMPD)

LMPD ID
LMP007760
Gene ID
945180
Species
Escherichia coli K-12 (E. coli)
Gene Name
regulator of length of O-antigen component of lipopolysaccharide chains
Gene Symbol
fepE
Synonyms
ECK0580; JW0579
Summary
FepE is believed to be a component of the ferric enterobactin transport system, because mutation of fepE disrupts uptake of enterobactin . [More information is available at EcoCyc: EG10297].
Orthologs
View orthologs and multiple alignments for fepE

Proteins

regulator of length of O-antigen component of lipopolysaccharide chains [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415119
Protein GI 16128570
UniProt ID P26266
Length 377
RefSeq Status REVIEWED
MSSLNIKQGSDAHFPDYPLASPSNNEIDLLNLISVLWRAKKTVMAVVFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKSFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKKDEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISTLVVKESLENVRNKLEIKTQFEKEKLAQDRIKTKNQLDANIQRLNYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKAHVNDVNFTPFKYQLSPSLPVKKDGPGKAIIVILSALIGGMVACGGVLLRYAMASRKQDAMMADHLV

Gene Information

Entrez Gene ID
945180
Gene Name
regulator of length of O-antigen component of lipopolysaccharide chains
Gene Symbol
fepE
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IDA:EcoCyc C plasma membrane
GO:0015620 IMP:EcoCyc F ferric-enterobactin transmembrane transporter activity
GO:0015685 IMP:EcoCyc P ferric-enterobactin transport
GO:0055072 IEA:UniProtKB-KW P iron ion homeostasis
GO:0009103 IEA:InterPro P lipopolysaccharide biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR003856 LipoPS_biosynth

UniProt Annotations

Entry Information

Gene Name
regulator of length of O-antigen component of lipopolysaccharide chains
Protein Entry
FEPE_ECOLI
UniProt ID
P26266
Species
E. coli

Comments

Comment Type Description
Function Part of the ferric enterobactin transport system.
Induction Repressed by H-NS, induced by LeuO. A monocistronic operon. {ECO:0000269|PubMed:19429622}.
Similarity Belongs to the WzzB/Cld/Rol family. {ECO:0000305}.
Subcellular Location Cell inner membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP007760 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16128570 RefSeq NP_415119 377 regulator of length of O-antigen component of lipopolysaccharide chains [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007760 proteins

Reference Database Accession Length Protein Name
GI:16128570 GenBank KHH67510.1 377 O-antigen length regulator [Escherichia coli]
GI:16128570 GenBank KHH83957.1 377 O-antigen length regulator [Escherichia coli]
GI:16128570 GenBank KHH92974.1 377 O-antigen length regulator [Escherichia coli]
GI:16128570 GenBank KHH93991.1 377 O-antigen length regulator [Escherichia coli]
GI:16128570 GenBank KHI87977.1 377 O-antigen length regulator [Escherichia coli]
GI:16128570 gnl IGS 377 regulator of length of O-antigen component of lipopolysaccharide chains [Escherichia coli ER2796]

Related Sequences to LMP007760 proteins

Reference Database Accession Length Protein Name
GI:16128570 GenBank EDV83603.1 377 ferric enterobactin transport protein fepE [Escherichia coli E22]
GI:16128570 GenBank EDX30193.1 377 ferric enterobactin transport protein fepE [Escherichia coli B171]
GI:16128570 GenBank EGJ07419.1 377 ferric enterobactin transport protein FepE [Escherichia coli D9]
GI:16128570 GenBank EGX15446.1 377 ferric enterobactin transport protein fepE [Escherichia coli STEC_H.1.8]
GI:16128570 GenBank EMX21862.1 377 ferric enterobactin transport protein fepE [Escherichia coli P0301867.1]
GI:16128570 GenBank KHI82217.1 377 O-antigen length regulator [Escherichia coli]