Gene/Proteome Database (LMPD)

LMPD ID
LMP007759
Gene ID
947364
Species
Escherichia coli K-12 (E. coli)
Gene Name
octaprenyl diphosphate synthase
Gene Symbol
ispB
Synonyms
ECK3176; JW3154; cel; yhbD
Summary
Octaprenyl diphosphate (OPP) synthase catalyzes the condensation reactions resulting in the formation of OPP, the isoprenoid side chain of |FRAME: [More information is available at EcoCyc: EG10017].
Orthologs
View orthologs and multiple alignments for ispB

Proteins

octaprenyl diphosphate synthase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_417654
Protein GI 16131077
UniProt ID P0AD57
Length 323
RefSeq Status REVIEWED
MNLEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYEGNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLHAMHHGTPEQAQMIRTAIEQGNGRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQVLPDTPWREALIGLAHIAVQRDR

Gene Information

Entrez Gene ID
947364
Gene Name
octaprenyl diphosphate synthase
Gene Symbol
ispB
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042802 IPI:IntAct F identical protein binding
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0004659 IDA:EcoCyc F prenyltransferase activity
GO:0016094 IMP:EcoCyc P polyprenol biosynthetic process
GO:0006744 IMP:EcoCyc P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco01110 Biosynthesis of secondary metabolites
eco00900 Terpenoid backbone biosynthesis
ko00900 Terpenoid backbone biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5783 octaprenyl diphosphate biosynthesis
PWY-5783 octaprenyl diphosphate biosynthesis
PWY-5783 octaprenyl diphosphate biosynthesis
POLYISOPRENSYN-PWY polyisoprenoid biosynthesis (E. coli)
POLYISOPRENSYN-PWY polyisoprenoid biosynthesis (E. coli)
ALL-CHORISMATE-PWY superpathway of chorismate metabolism
ALL-CHORISMATE-PWY superpathway of chorismate metabolism
PWY-5861 superpathway of demethylmenaquinol-8 biosynthesis
PWY-5838 superpathway of menaquinol-8 biosynthesis I
PWY-5838 superpathway of menaquinol-8 biosynthesis I
UBISYN-PWY superpathway of ubiquinol-8 biosynthesis (prokaryotic)
UBISYN-PWY superpathway of ubiquinol-8 biosynthesis (prokaryotic)

Domain Information

InterPro Annotations

Accession Description
IPR008949 Isoprenoid synthase domain
IPR000092 Polyprenyl synthetase
IPR017446 Polyprenyl synthetase-related

UniProt Annotations

Entry Information

Gene Name
octaprenyl diphosphate synthase
Protein Entry
ISPB_ECOLI
UniProt ID
P0AD57
Species
E. coli

Comments

Comment Type Description
Catalytic Activity (2E,6E)-farnesyl diphosphate + 5 isopentenyl diphosphate = 5 diphosphate + all-trans-octaprenyl diphosphate. {ECO:0000269|PubMed:8037730}.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Note=Binds 3 Mg(2+) ions per subunit. {ECO:0000250};
Function Supplies octaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone and menaquinone. {ECO:0000269|PubMed:8037730}.
Interaction Self; NbExp=2; IntAct=EBI-1131851, EBI-1131851; O13851:dlp1 (xeno); NbExp=2; IntAct=EBI-1131851, EBI-7701234; O43091:dps1 (xeno); NbExp=2; IntAct=EBI-1131851, EBI-7701164;
Similarity Belongs to the FPP/GGPP synthase family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007759 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16131077 RefSeq NP_417654 323 octaprenyl diphosphate synthase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007759 proteins

Reference Database Accession Length Protein Name
GI:16131077 GenBank KHJ07258.1 323 octaprenyl diphosphate synthase [Escherichia coli]
GI:16131077 GenBank KHJ13778.1 323 octaprenyl diphosphate synthase [Escherichia coli]
GI:16131077 GenBank KHJ16509.1 323 octaprenyl diphosphate synthase [Escherichia coli]
GI:16131077 GenBank KHJ25767.1 323 octaprenyl diphosphate synthase [Escherichia coli]
GI:16131077 GenBank KHJ26169.1 323 octaprenyl diphosphate synthase [Escherichia coli]
GI:16131077 gnl IGS 323 octaprenyl diphosphate synthase [Escherichia coli ER2796]

Related Sequences to LMP007759 proteins

Reference Database Accession Length Protein Name
GI:16131077 PDB 3WJK 337 Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Escherichia Coli
GI:16131077 PDB 3WJK 337 Chain B, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Escherichia Coli
GI:16131077 PDB 3WJN 337 Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Escherichia Coli With Farnesyl S-thiol-pyrophosphate (fspp)
GI:16131077 PDB 3WJN 337 Chain B, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Escherichia Coli With Farnesyl S-thiol-pyrophosphate (fspp)
GI:16131077 PDB 3WJO 337 Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Escherichia Coli With Isopentenyl Pyrophosphate (ipp)
GI:16131077 PDB 3WJO 337 Chain B, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Escherichia Coli With Isopentenyl Pyrophosphate (ipp)