Gene/Proteome Database (LMPD)
LMPD ID
LMP007753
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
short chain acyltransferase
Gene Symbol
Synonyms
ECK2842; JW5453
Summary
yqeF encodes a predicted acetyl-CoA acetyltransferase . yqeF is induced during a second phase of growth on mucus when genes for anaerobic respiration, ethanolamine and fucose degradation, and the TCA cycle are induced . yqeF was shown to be upregulated in glucose-limited chemostat cultures . [More information is available at EcoCyc: G7464].
Orthologs
Proteins
| short chain acyltransferase [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_417321 |
| Protein GI | 90111494 |
| UniProt ID | Q46939 |
| Length | 393 |
| RefSeq Status | REVIEWED |
| MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAGAGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSRAPHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYALSSQQKARAAIDAGRFKDEIVPVMTQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGSVTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCLERVGWQLAEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVSLVHEMVKRNARKGLATLCIGGGQGVALTIERDE | |
Gene Information
Entrez Gene ID
Gene Name
short chain acyltransferase
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0003985 | IEA:UniProtKB-EC | F | acetyl-CoA C-acetyltransferase activity |
| GO:0003988 | IMP:EcoCyc | F | acetyl-CoA C-acyltransferase activity |
| GO:0071271 | IMP:CACAO | P | 1-butanol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco00362 | Benzoate degradation |
| ko00362 | Benzoate degradation |
| eco01110 | Biosynthesis of secondary metabolites |
| eco00650 | Butanoate metabolism |
| ko00650 | Butanoate metabolism |
| eco01200 | Carbon metabolism |
| ko01200 | Carbon metabolism |
| eco00071 | Fatty acid degradation |
| ko00071 | Fatty acid degradation |
| eco01212 | Fatty acid metabolism |
| ko01212 | Fatty acid metabolism |
| eco00630 | Glyoxylate and dicarboxylate metabolism |
| ko00630 | Glyoxylate and dicarboxylate metabolism |
| eco00310 | Lysine degradation |
| ko00310 | Lysine degradation |
| eco01100 | Metabolic pathways |
| eco01120 | Microbial metabolism in diverse environments |
| eco00640 | Propanoate metabolism |
| ko00640 | Propanoate metabolism |
| eco00620 | Pyruvate metabolism |
| ko00620 | Pyruvate metabolism |
| eco00900 | Terpenoid backbone biosynthesis |
| ko00900 | Terpenoid backbone biosynthesis |
| eco00380 | Tryptophan metabolism |
| ko00380 | Tryptophan metabolism |
| eco02020 | Two-component system |
| ko02020 | Two-component system |
| eco00280 | Valine, leucine and isoleucine degradation |
| ko00280 | Valine, leucine and isoleucine degradation |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2 acetyl-CoA = CoA + acetoacetyl-CoA. {ECO:0000255|PROSITE-ProRule:PRU10020}. |
| Sequence Caution | Sequence=AAB40491.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; |
| Similarity | Belongs to the thiolase family. {ECO:0000305}. |
| Subcellular Location | Cytoplasm {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007753 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 90111494 | RefSeq | NP_417321 | 393 | short chain acyltransferase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007753 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:90111494 | GenBank | KHD55751.1 | 393 | acetyl-CoA acetyltransferase [Escherichia coli] |
| GI:90111494 | GenBank | KHH67336.1 | 393 | acetyl-CoA acetyltransferase [Escherichia coli] |
| GI:90111494 | GenBank | KHH88971.1 | 393 | acetyl-CoA acetyltransferase [Escherichia coli] |
| GI:90111494 | GenBank | KHH95550.1 | 393 | acetyl-CoA acetyltransferase [Escherichia coli] |
| GI:90111494 | GenBank | KHI20360.1 | 393 | acetyl-CoA acetyltransferase [Escherichia coli] |
| GI:90111494 | GenBank | KHI58885.1 | 393 | acetyl-CoA acetyltransferase [Escherichia coli] |
Related Sequences to LMP007753 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:90111494 | GenBank | AAB40491.1 | 394 | ORF_f394 [Escherichia coli str. K-12 substr. MG1655] |
| GI:90111494 | GenBank | ABZ49600.1 | 394 | Sequence 23538 from patent US 7314974 |
| GI:90111494 | GenBank | EIE38442.1 | 394 | acetyl-CoA C-acetyltransferase [Escherichia coli J53] |
| GI:90111494 | GenBank | ESA61478.1 | 393 | acetyl-CoA C-acetyltransferase [Escherichia coli 113303] |
| GI:90111494 | GenBank | ESA87683.1 | 393 | acetyl-CoA C-acetyltransferase [Escherichia coli 909945-2] |
| GI:90111494 | GenBank | ESP36761.1 | 393 | acyltransferase [Escherichia coli HVH 152 (4-3447545)] |