Gene/Proteome Database (LMPD)

LMPD ID
LMP007746
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
outer membrane-specific lipoprotein transporter subunit
Gene Symbol
Synonyms
ECK1103; JW5162; ycfV
Summary
LolD is the ATP-binding component of the LolCDE lipoprotein export ABC transporter. [More information is available at EcoCyc: G6574].
Orthologs

Proteins

outer membrane-specific lipoprotein transporter subunit [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415635
Protein GI 90111215
UniProt ID P75957
Length 233
RefSeq Status REVIEWED
MNKILLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPAEINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAE

Gene Information

Entrez Gene ID
Gene Name
outer membrane-specific lipoprotein transporter subunit
Gene Symbol
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043190 IEA:UniProtKB-HAMAP C ATP-binding cassette (ABC) transporter complex
GO:0005886 IDA:EcoCyc C plasma membrane
GO:0043234 IDA:EcoCyc C protein complex
GO:0005524 IEA:UniProtKB-HAMAP F ATP binding
GO:0016887 IEA:InterPro F ATPase activity
GO:0042954 IDA:EcoCyc F lipoprotein transporter activity
GO:0042953 IDA:EcoCyc P lipoprotein transport

KEGG Pathway Links

KEGG Pathway ID Description
eco02010 ABC transporters
ko02010 ABC transporters
M00255 Lipoprotein-releasing system
eco_M00255 Lipoprotein-releasing system

Domain Information

InterPro Annotations

Accession Description
IPR003593 AAA+ ATPase domain
IPR017871 ABC transporter, conserved site
IPR003439 ABC_transporter-like
IPR015854 ABC_transpr_LolD
IPR011924 LolD_lipo_ATP-bd
IPR027417 P-loop containing nucleoside triphosphate hydrolase

UniProt Annotations

Entry Information

Gene Name
outer membrane-specific lipoprotein transporter subunit
Protein Entry
LOLD_ECOLI
UniProt ID
Species
E. coli

Comments

Comment Type Description
Function Part of the ABC transporter complex LolCDE involved in the translocation of mature outer membrane-directed lipoproteins, from the inner membrane to the periplasmic chaperone, LolA. Responsible for the formation of the LolA-lipoprotein complex in an ATP-dependent manner. Such a release is dependent of the sorting-signal (absence of an Asp at position 2 of the mature lipoprotein) and of LolA.
Similarity Belongs to the ABC transporter superfamily. Lipoprotein translocase (TC 3.A.1.125) family. {ECO:0000255|HAMAP- Rule:MF_01708}.
Similarity Contains 1 ABC transporter domain. {ECO:0000255|HAMAP- Rule:MF_01708}.
Subcellular Location Cell inner membrane; Peripheral membrane protein.
Subunit The complex is composed of two ATP-binding proteins (LolD) and two transmembrane proteins (LolC and LolE). {ECO:0000255|HAMAP-Rule:MF_01708, ECO:0000269|PubMed:11844772}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007746 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
90111215 RefSeq NP_415635 233 outer membrane-specific lipoprotein transporter subunit [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007746 proteins

Reference Database Accession Length Protein Name
GI:90111215 GenBank KHJ02987.1 233 lipoprotein ABC transporter ATP-binding protein [Escherichia coli]
GI:90111215 GenBank KHJ05651.1 233 lipoprotein ABC transporter ATP-binding protein [Escherichia coli]
GI:90111215 GenBank KHJ10616.1 233 lipoprotein ABC transporter ATP-binding protein [Escherichia coli]
GI:90111215 GenBank KHJ17543.1 233 lipoprotein ABC transporter ATP-binding protein [Escherichia coli]
GI:90111215 GenBank KHJ22745.1 233 lipoprotein ABC transporter ATP-binding protein [Escherichia coli]
GI:90111215 gnl IGS 233 outer membrane-specific lipoprotein transporter subunit [Escherichia coli ER2796]

Related Sequences to LMP007746 proteins

Reference Database Accession Length Protein Name
GI:90111215 GenBank EHW40693.1 233 liporeleasing system, ATP-binding protein [Escherichia coli DEC9A]
GI:90111215 GenBank EHW62012.1 233 liporeleasing system, ATP-binding protein [Escherichia coli DEC9E]
GI:90111215 gnl zhongguo 279 ABC transporter, ATP-binding protein [Escherichia coli P12b]
GI:90111215 RefSeq YP_006169008.1 279 ABC transporter ATP-binding protein [Escherichia coli P12b]
GI:90111215 RefSeq WP_001033686.1 233 peptide ABC transporter ATP-binding protein [Escherichia coli]
GI:90111215 RefSeq WP_014640957.1 279 peptide ABC transporter ATP-binding protein [Escherichia coli]