Gene/Proteome Database (LMPD)

LMPD ID
LMP007735
Gene ID
946799
Species
Escherichia coli K-12 (E. coli)
Gene Name
3-oxoacyl-[acyl-carrier-protein] synthase I
Gene Symbol
fabB
Synonyms
ECK2317; JW2320; fabC
Summary
There are three -ketoacyl-ACP synthases (KAS) in Escherichia coli: |FRAME: [More information is available at EcoCyc: EG10274].
Orthologs
View orthologs and multiple alignments for fabB

Proteins

3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_416826
Protein GI 16130258
UniProt ID P0A953
Length 406
RefSeq Status REVIEWED
MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD

Gene Information

Entrez Gene ID
946799
Gene Name
3-oxoacyl-[acyl-carrier-protein] synthase I
Gene Symbol
fabB
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:UniProtKB C cytosol
GO:0004315 IDA:EcoCyc F 3-oxoacyl-[acyl-carrier-protein] synthase activity
GO:0006633 IMP:EcoCyc P fatty acid biosynthetic process
GO:0008610 IGI:EcoliWiki P lipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco00780 Biotin metabolism
ko00780 Biotin metabolism
eco00061 Fatty acid biosynthesis
ko00061 Fatty acid biosynthesis
M00083 Fatty acid biosynthesis, elongation
eco_M00083 Fatty acid biosynthesis, elongation
eco01212 Fatty acid metabolism
ko01212 Fatty acid metabolism
eco01100 Metabolic pathways
M00572 Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
eco_M00572 Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6519 8-amino-7-oxononanoate biosynthesis I
PWY-6519 8-amino-7-oxononanoate biosynthesis I
BIOTIN-BIOSYNTHESIS-PWY biotin biosynthesis I
BIOTIN-BIOSYNTHESIS-PWY biotin biosynthesis I
PWY0-862 cis-dodecenoyl biosynthesis
PWY0-862 cis-dodecenoyl biosynthesis
PWY0-862 cis-dodecenoyl biosynthesis
PWY-5973 cis-vaccenate biosynthesis
PWY-5966 fatty acid biosynthesis initiation II
PWY-5966 fatty acid biosynthesis initiation II
PWY-5966 fatty acid biosynthesis initiation II
PWY-5965 fatty acid biosynthesis initiation III
PWY-5965 fatty acid biosynthesis initiation III
PWY-5965 fatty acid biosynthesis initiation III
FASYN-ELONG-PWY fatty acid elongation -- saturated
FASYN-ELONG-PWY fatty acid elongation -- saturated
FASYN-ELONG-PWY fatty acid elongation -- saturated
PWY-5971 palmitate biosynthesis II (bacteria and plants)
PWY-5971 palmitate biosynthesis II (bacteria and plants)
PWY-5971 palmitate biosynthesis II (bacteria and plants)
PWY-6282 palmitoleate biosynthesis I
PWY-6282 palmitoleate biosynthesis I
PWY0-881 superpathway of fatty acid biosynthesis I (E. coli)
PWY0-881 superpathway of fatty acid biosynthesis I (E. coli)
FASYN-INITIAL-PWY superpathway of fatty acid biosynthesis initiation (E. coli)
FASYN-INITIAL-PWY superpathway of fatty acid biosynthesis initiation (E. coli)
FASYN-INITIAL-PWY superpathway of fatty acid biosynthesis initiation (E. coli)
PWY-6285 superpathway of fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)

Domain Information

InterPro Annotations

Accession Description
IPR014031 Beta-ketoacyl synthase, C-terminal
IPR014030 Beta-ketoacyl synthase, N-terminal
IPR018201 Beta-ketoacyl synthase, active site
IPR016039 Thiolase-like
IPR016038 Thiolase-like, subgroup

UniProt Annotations

Entry Information

Gene Name
3-oxoacyl-[acyl-carrier-protein] synthase I
Protein Entry
FABB_ECOLI
UniProt ID
P0A953
Species
E. coli

Comments

Comment Type Description
Catalytic Activity Acyl-[acyl-carrier-protein] + malonyl-[acyl- carrier-protein] = 3-oxoacyl-[acyl-carrier-protein] + CO(2) + [acyl-carrier-protein].
Function Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Specific for elongation from C-10 to unsaturated C-16 and C-18 fatty acids. {ECO:0000269|PubMed:3076377}.
Pathway Lipid metabolism; fatty acid biosynthesis.
Similarity Belongs to the beta-ketoacyl-ACP synthases family. {ECO:0000305}.
Subcellular Location Cytoplasm.
Subunit Homodimer.

Identical and Related Proteins

Unique RefSeq proteins for LMP007735 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16130258 RefSeq NP_416826 406 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007735 proteins

Reference Database Accession Length Protein Name
GI:16130258 GenBank KHI96167.1 406 3-oxoacyl-ACP synthase [Escherichia coli]
GI:16130258 GenBank KHJ09964.1 406 3-oxoacyl-ACP synthase [Escherichia coli]
GI:16130258 GenBank KHJ14628.1 406 3-oxoacyl-ACP synthase [Escherichia coli]
GI:16130258 GenBank KHJ21286.1 406 3-oxoacyl-ACP synthase [Escherichia coli]
GI:16130258 GenBank KHJ26594.1 406 3-oxoacyl-ACP synthase [Escherichia coli]
GI:16130258 gnl IGS 406 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli ER2796]

Related Sequences to LMP007735 proteins

Reference Database Accession Length Protein Name
GI:16130258 GenBank EII96057.1 406 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli TW07793]
GI:16130258 GenBank KDX61032.1 406 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli 2-210-07_S4_C2]
GI:16130258 GenBank KDX68388.1 406 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli 2-210-07_S4_C3]
GI:16130258 RefSeq WP_000817171.1 406 3-oxoacyl-ACP synthase [Escherichia coli]
GI:16130258 RefSeq WP_024224009.1 406 3-oxoacyl-ACP synthase [Escherichia coli]
GI:16130258 RefSeq WP_032170074.1 406 3-oxoacyl-ACP synthase [Escherichia coli]