Gene/Proteome Database (LMPD)

LMPD ID
LMP007725
Gene ID
946175
Species
Escherichia coli K-12 (E. coli)
Gene Name
murein lipoprotein
Gene Symbol
lpp
Synonyms
ECK1673; JW1667; mlpA; mulI
Summary
Lpp binds peptidoglycan, one third has a covalent bond to murein. [More information is available at EcoGene: EG10544]. Lpp, the major lipoprotein, is one of the most abundant proteins in Escherichia coli and is necessary for the stabilization and integrity of the bacterial cell envelope . [More information is available at EcoCyc: EG10544].
Orthologs
View orthologs and multiple alignments for lpp

Proteins

murein lipoprotein [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_416192
Protein GI 16129633
UniProt ID P69776
Length 78
RefSeq Status REVIEWED
MKATKLVLGAVILGSTLLAGCSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK

Gene Information

Entrez Gene ID
946175
Gene Name
murein lipoprotein
Gene Symbol
lpp
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009279 NAS:UniProtKB C cell outer membrane
GO:0045203 IDA:EcoCyc C integral component of cell outer membrane
GO:0016020 IDA:UniProtKB C membrane
GO:0042802 IPI:IntAct F identical protein binding
GO:0008289 NAS:UniProtKB F lipid binding
GO:0042834 TAS:UniProtKB F peptidoglycan binding
GO:0030258 IMP:UniProtKB P lipid modification

Domain Information

InterPro Annotations

Accession Description
IPR006817 Lipoprotein_leucine-zipper_dom
IPR016367 Murein-lipoprotein

UniProt Annotations

Entry Information

Gene Name
murein lipoprotein
Protein Entry
LPP_ECOLI
UniProt ID
P69776
Species
E. coli

Comments

Comment Type Description
Function Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope.
Interaction Self; NbExp=2; IntAct=EBI-909750, EBI-909750; P02929:tonB; NbExp=2; IntAct=EBI-909750, EBI-6399993;
Miscellaneous About one-third of Lpp is covalently bound to peptidoglycan.
Similarity Belongs to the Lpp family. {ECO:0000305}.
Subcellular Location Cell outer membrane; Lipid-anchor. Cell outer membrane; Peptidoglycan-anchor. Note=Found in the inner leaflet of the outer membrane. Targeted by the SRP/Sec/YidC pathway.
Subunit Homotrimer. Seems to interact with TolB, Pal and TonB. Has been isolated from outer membrane preparations as an approximately 87 kDa complex, suggesting it also forms larger complexes. {ECO:0000269|PubMed:10843861, ECO:0000269|PubMed:16079137, ECO:0000269|PubMed:3013869}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007725 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16129633 RefSeq NP_416192 78 murein lipoprotein [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007725 proteins

Reference Database Accession Length Protein Name
GI:16129633 GenBank KHJ08357.1 78 murein lipoprotein [Escherichia coli]
GI:16129633 GenBank KHJ12563.1 78 murein lipoprotein [Escherichia coli]
GI:16129633 GenBank KHJ19074.1 78 murein lipoprotein [Escherichia coli]
GI:16129633 GenBank KHJ24532.1 78 murein lipoprotein [Escherichia coli]
GI:16129633 GenBank KHJ28311.1 78 murein lipoprotein [Escherichia coli]
GI:16129633 gnl IGS 78 murein lipoprotein [Escherichia coli ER2796]

Related Sequences to LMP007725 proteins

Reference Database Accession Length Protein Name
GI:16129633 GenBank EII66728.1 78 murein-lipoprotein [Escherichia coli 2.4168]
GI:16129633 GenBank EKK45456.1 78 major outer membrane lipoprotein Lpp [Escherichia coli 8.0566]
GI:16129633 GenBank EKK46672.1 78 major outer membrane lipoprotein Lpp [Escherichia coli 8.0569]
GI:16129633 GenBank EMU69819.1 79 major outer membrane lipoprotein Lpp [Escherichia coli MP021552.12]
GI:16129633 RefSeq WP_000648418.1 78 murein lipoprotein [Escherichia coli]
GI:16129633 RefSeq WP_001681102.1 79 major outer membrane lipoprotein Lpp [Escherichia coli]