Gene/Proteome Database (LMPD)

LMPD ID
LMP007724
Gene ID
946563
Species
Escherichia coli K-12 (E. coli)
Gene Name
bifunctional GDP-fucose synthetase: GDP-4-dehydro-6-deoxy-D-mannose epimerase/ GDP-4-dehydro-6-L-deoxygalactose reductase
Gene Symbol
wcaG
Synonyms
ECK2046; JW2037; fcl; yefB
Summary
GDP-fucose synthase is a bifunctional enzyme that catalyzes the two-step synthesis of GDP-fucose from GDP-4-dehydro-6-deoxy-D-mannose via a GDP-4-dehydro-6-L-deoxygalactose intermediate . [More information is available at EcoCyc: EG11788].
Orthologs
View orthologs and multiple alignments for wcaG

Proteins

bifunctional GDP-fucose synthetase: GDP-4-dehydro-6-deoxy-D-mannose epimerase/ GDP-4-dehydro-6-L-deoxygalactose reductase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_416556
Protein GI 16129992
UniProt ID P32055
Length 321
RefSeq Status REVIEWED
MSKQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQDRFRG

Gene Information

Entrez Gene ID
946563
Gene Name
bifunctional GDP-fucose synthetase: GDP-4-dehydro-6-deoxy-D-mannose epimerase/ GDP-4-dehydro-6-L-deoxygalactose reductase
Gene Symbol
wcaG
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0050577 IDA:EcoCyc F GDP-L-fucose synthase activity
GO:0070401 IEA:UniProtKB-HAMAP F NADP+ binding
GO:0016853 IEA:UniProtKB-KW F isomerase activity
GO:0042351 IEA:UniProtKB-HAMAP P 'de novo' GDP-L-fucose biosynthetic process
GO:0009242 IEA:UniProtKB-UniPathway P colanic acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco00520 Amino sugar and nucleotide sugar metabolism
ko00520 Amino sugar and nucleotide sugar metabolism
eco00051 Fructose and mannose metabolism
ko00051 Fructose and mannose metabolism
eco01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-66 GDP-L-fucose biosynthesis I (from GDP-D-mannose)
PWY-66 GDP-L-fucose biosynthesis I (from GDP-D-mannose)
COLANSYN-PWY colanic acid building blocks biosynthesis
COLANSYN-PWY colanic acid building blocks biosynthesis
PWY-7323 superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR028614 GDP_fucose_synth
IPR016040 NAD(P)-binding domain
IPR001509 NAD-dependent epimerase/dehydratase, N-terminal domain

UniProt Annotations

Entry Information

Gene Name
bifunctional GDP-fucose synthetase: GDP-4-dehydro-6-deoxy-D-mannose epimerase/ GDP-4-dehydro-6-L-deoxygalactose reductase
Protein Entry
FCL_ECOLI
UniProt ID
P32055
Species
E. coli

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=9 uM for NADPH {ECO:0000269|PubMed:10480878, ECO:0000269|PubMed:11021971}; KM=109 uM for NADH {ECO:0000269|PubMed:10480878, ECO:0000269|PubMed:11021971}; KM=29 uM for GDP-4-keto-6-deoxymannose {ECO:0000269|PubMed:10480878, ECO:0000269|PubMed:11021971}; Vmax=363.5 umol/min/mg enzyme {ECO:0000269|PubMed:10480878, ECO:0000269|PubMed:11021971}; pH dependence: Optimum pH is 6-6.5. {ECO:0000269|PubMed:10480878, ECO:0000269|PubMed:11021971};
Catalytic Activity GDP-beta-L-fucose + NADP(+) = GDP-4-dehydro-6- deoxy-alpha-D-mannose + NADPH. {ECO:0000255|HAMAP-Rule:MF_00956, ECO:0000269|PubMed:10480878, ECO:0000269|PubMed:11021971, ECO:0000269|PubMed:9473059}.
Enzyme Regulation Subject to product inhibition by NADP and GDP- fucose. {ECO:0000269|PubMed:10480878}.
Function Catalyzes the two-step NADP-dependent conversion of GDP- 4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction. {ECO:0000255|HAMAP-Rule:MF_00956, ECO:0000269|PubMed:10480878, ECO:0000269|PubMed:11021971, ECO:0000269|PubMed:9473059}.
Pathway Exopolysaccharide biosynthesis; colanic acid biosynthesis. {ECO:0000269|PubMed:9473059}.
Pathway Nucleotide-sugar biosynthesis; GDP-L-fucose biosynthesis via de novo pathway; GDP-L-fucose from GDP-alpha-D-mannose: step 2/2. {ECO:0000255|HAMAP-Rule:MF_00956, ECO:0000269|PubMed:9473059}.
Similarity Belongs to the NAD(P)-dependent epimerase/dehydratase family. Fucose synthase subfamily. {ECO:0000255|HAMAP- Rule:MF_00956}.
Subcellular Location Cytoplasm.
Subunit Homodimer. {ECO:0000269|PubMed:11021971, ECO:0000269|PubMed:9817848, ECO:0000269|PubMed:9862812}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007724 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16129992 RefSeq NP_416556 321 bifunctional GDP-fucose synthetase: GDP-4-dehydro-6-deoxy-D-mannose epimerase/ GDP-4-dehydro-6-L-deoxygalactose reductase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007724 proteins

Reference Database Accession Length Protein Name
GI:16129992 EMBL CDY59369.1 321 GDP-fucose synthase [Escherichia coli]
GI:16129992 EMBL CDZ20873.1 321 GDP-fucose synthase [Escherichia coli]
GI:16129992 GenBank KGL68980.1 321 bifunctional GDP-fucose synthetase:GDP-4-dehydro-6-deoxy-D-mannose epimerase/GDP-4-dehydro-6-L-deoxygalactose reductase [Escherichia coli NCTC 50110]
GI:16129992 GenBank KHH71774.1 321 GDP-fucose synthetase [Escherichia coli]
GI:16129992 gnl PRJNA260958 321 GDP-fucose synthetase [Escherichia coli FAP1]
GI:16129992 gnl IGS 321 bifunctional GDP-fucose synthetase: GDP-4-dehydro-6-deoxy-D-mannose epimerase/ GDP-4-dehydro-6-L-deoxygalactose reductase [Escherichia coli ER2796]

Related Sequences to LMP007724 proteins

Reference Database Accession Length Protein Name
GI:16129992 GenBank EIQ41333.1 321 GDP-L-fucose synthase [Shigella sonnei 3226-85]
GI:16129992 GenBank EIQ43608.1 321 GDP-L-fucose synthase [Shigella sonnei 3233-85]
GI:16129992 GenBank EIQ70068.1 321 NAD dependent epimerase/dehydratase family protein [Escherichia coli EPEC C342-62]
GI:16129992 GenBank ERO97048.1 321 GDP-L-fucose synthase [Escherichia coli BIDMC 19C]
GI:16129992 GenBank ESA26281.1 321 GDP-L-fucose synthetase [Escherichia coli SCD1]
GI:16129992 GenBank ESA67523.1 321 GDP-L-fucose synthetase [Escherichia coli 113290]