Gene/Proteome Database (LMPD)

LMPD ID
LMP007721
Gene ID
945870
Species
Escherichia coli K-12 (E. coli)
Gene Name
enoyl-[acyl-carrier-protein] reductase, NADH-dependent
Gene Symbol
fabI
Synonyms
ECK1283; JW1281; envM; gts; qmeA
Summary
fabI is an essential gene. [More information is available at EcoGene: EG11528]. The FabI protein is an enoyl acyl carrier protein reductase which catalyzes an essential step in fatty acid biosynthesis. [More information is available at EcoCyc: EG11528].
Orthologs
View orthologs and multiple alignments for fabI

Proteins

enoyl-[acyl-carrier-protein] reductase, NADH-dependent [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415804
Protein GI 16129249
UniProt ID P0AEK4
Length 262
RefSeq Status REVIEWED
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Gene Information

Entrez Gene ID
945870
Gene Name
enoyl-[acyl-carrier-protein] reductase, NADH-dependent
Gene Symbol
fabI
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IDA:UniProtKB C membrane
GO:0004318 IDA:UniProtKB F enoyl-[acyl-carrier-protein] reductase (NADH) activity
GO:0042802 IDA:EcoCyc F identical protein binding
GO:0009102 IMP:UniProtKB P biotin biosynthetic process
GO:0030497 IDA:UniProtKB P fatty acid elongation
GO:0008610 IDA:EcoCyc P lipid biosynthetic process
GO:0051289 IDA:UniProtKB P protein homotetramerization
GO:0046677 IEA:UniProtKB-KW P response to antibiotic

KEGG Pathway Links

KEGG Pathway ID Description
eco00780 Biotin metabolism
ko00780 Biotin metabolism
eco00061 Fatty acid biosynthesis
ko00061 Fatty acid biosynthesis
M00083 Fatty acid biosynthesis, elongation
eco_M00083 Fatty acid biosynthesis, elongation
eco01212 Fatty acid metabolism
ko01212 Fatty acid metabolism
eco01100 Metabolic pathways
M00572 Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
eco_M00572 Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6519 8-amino-7-oxononanoate biosynthesis I
PWY-6519 8-amino-7-oxononanoate biosynthesis I
BIOTIN-BIOSYNTHESIS-PWY biotin biosynthesis I
BIOTIN-BIOSYNTHESIS-PWY biotin biosynthesis I
PWY0-862 cis-dodecenoyl biosynthesis
PWY0-862 cis-dodecenoyl biosynthesis
PWY-5973 cis-vaccenate biosynthesis
PWY-5973 cis-vaccenate biosynthesis
FASYN-ELONG-PWY fatty acid elongation -- saturated
FASYN-ELONG-PWY fatty acid elongation -- saturated
FASYN-ELONG-PWY fatty acid elongation -- saturated
PWY-5971 palmitate biosynthesis II (bacteria and plants)
PWY-5971 palmitate biosynthesis II (bacteria and plants)
PWY-6282 palmitoleate biosynthesis I
PWY-6282 palmitoleate biosynthesis I
PWY0-881 superpathway of fatty acid biosynthesis I (E. coli)
PWY0-881 superpathway of fatty acid biosynthesis I (E. coli)
PWY-6285 superpathway of fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)

Domain Information

InterPro Annotations

Accession Description
IPR014358 Enoyl-ACP_Rdtase_NADH
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain

UniProt Annotations

Entry Information

Gene Name
enoyl-[acyl-carrier-protein] reductase, NADH-dependent
Protein Entry
FABI_ECOLI
UniProt ID
P0AEK4
Species
E. coli

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=3.3 uM for trans-2-dodecenoyl-ACP (DD-ACP)(at 25 degrees Celsius and pH 8) {ECO:0000269|PubMed:17012233, ECO:0000269|PubMed:8119879}; KM=22 uM for crotonyl-ACP (at 30 degrees Celsius and pH 7.5) {ECO:0000269|PubMed:17012233, ECO:0000269|PubMed:8119879}; KM=24 uM for trans-2-dodecenoyl-CoA (DD-CoA)(at 25 degrees Celsius and pH 8) {ECO:0000269|PubMed:17012233, ECO:0000269|PubMed:8119879}; KM=2700 uM for crotonyl-CoA (at 30 degrees Celsius and pH 7.5) {ECO:0000269|PubMed:17012233, ECO:0000269|PubMed:8119879};
Catalytic Activity An acyl-[acyl-carrier protein] + NAD(+) = a trans-2,3-dehydroacyl-[acyl-carrier protein] + NADH. {ECO:0000269|PubMed:8119879}.
Enzyme Regulation Inhibited by diazaborines, triclosan (5-chloro- 2-2,4-dichlorophenoxyphenol), 1,4-disubstituted imidazoles, 1,4- benzodiazepine derivatives, naphthyridinone derivatives, luteolin and curcumin. {ECO:0000269|PubMed:10398587, ECO:0000269|PubMed:10493822, ECO:0000269|PubMed:11514139, ECO:0000269|PubMed:12109908, ECO:0000269|PubMed:12699381, ECO:0000269|PubMed:19959361, ECO:0000269|PubMed:8119879, ECO:0000269|PubMed:8953047, ECO:0000269|PubMed:9707111}.
Function Catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). Involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis. {ECO:0000269|PubMed:20693992, ECO:0000269|PubMed:7592873, ECO:0000269|PubMed:8119879}.
Miscellaneous The antibiotic diazaborine interferes with the activity by binding to the protein and NAD.
Pathway Cofactor biosynthesis; biotin biosynthesis.
Pathway Lipid metabolism; fatty acid biosynthesis.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. FabI subfamily. {ECO:0000305}.
Subunit Homotetramer. {ECO:0000269|PubMed:10201369, ECO:0000269|PubMed:10398587, ECO:0000269|PubMed:10493822, ECO:0000269|PubMed:10595560, ECO:0000269|PubMed:11514139, ECO:0000269|PubMed:12109908, ECO:0000269|PubMed:12699381, ECO:0000269|PubMed:8953047}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007721 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16129249 RefSeq NP_415804 262 enoyl-[acyl-carrier-protein] reductase, NADH-dependent [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007721 proteins

Reference Database Accession Length Protein Name
GI:16129249 GenBank KHJ06731.1 262 enoyl-ACP reductase [Escherichia coli]
GI:16129249 GenBank KHJ13529.1 262 enoyl-ACP reductase [Escherichia coli]
GI:16129249 GenBank KHJ17877.1 262 enoyl-ACP reductase [Escherichia coli]
GI:16129249 GenBank KHJ21095.1 262 enoyl-ACP reductase [Escherichia coli]
GI:16129249 GenBank KHJ26337.1 262 enoyl-ACP reductase [Escherichia coli]
GI:16129249 gnl IGS 262 enoyl-[acyl-carrier-protein] reductase, NADH-dependent [Escherichia coli ER2796]

Related Sequences to LMP007721 proteins

Reference Database Accession Length Protein Name
GI:16129249 PDB 1QSG 265 Chain B, Crystal Structure Of Enoyl Reductase Inhibition By Triclosan
GI:16129249 PDB 1QSG 265 Chain C, Crystal Structure Of Enoyl Reductase Inhibition By Triclosan
GI:16129249 PDB 1QSG 265 Chain D, Crystal Structure Of Enoyl Reductase Inhibition By Triclosan
GI:16129249 PDB 1QSG 265 Chain E, Crystal Structure Of Enoyl Reductase Inhibition By Triclosan
GI:16129249 PDB 1QSG 265 Chain F, Crystal Structure Of Enoyl Reductase Inhibition By Triclosan
GI:16129249 PDB 1QSG 265 Chain G, Crystal Structure Of Enoyl Reductase Inhibition By Triclosan