Gene/Proteome Database (LMPD)

LMPD ID
LMP007678
Gene ID
945344
Species
Escherichia coli K-12 (E. coli)
Gene Name
undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit
Gene Symbol
arnF
Synonyms
ECK2252; JW5373; pbgE3; pmrM; yfbJ
Summary
Involved in the modification of lipid A phosphates with aminoarabinose that is required for polymyxin B and cationic antimicrobial peptide resistance. [More information is available at EcoGene: EG14094]. ArnF is an integral membrane component of the ArnE/ArnF undecaprenyl-phosphate--L-Ara4N flippase. [More information is available at EcoCyc: G7171].
Orthologs
View orthologs and multiple alignments for arnF

Proteins

undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_416761
Protein GI 90111409
UniProt ID P76474
Length 128
RefSeq Status REVIEWED
MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLSVFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIFLPTTKQRY

Gene Information

Entrez Gene ID
945344
Gene Name
undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit
Gene Symbol
arnF
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005887 IEA:UniProtKB-HAMAP C integral component of plasma membrane
GO:0022891 IMP:EcoCyc F substrate-specific transmembrane transporter activity
GO:0009245 IEA:UniProtKB-HAMAP P lipid A biosynthetic process
GO:0009103 IEA:UniProtKB-UniPathway P lipopolysaccharide biosynthetic process
GO:0010041 IGI:EcoCyc P response to iron(III) ion
GO:0006810 IMP:EcoCyc P transport

Domain Information

InterPro Annotations

Accession Description
IPR022832 Flippase_ArnF

UniProt Annotations

Entry Information

Gene Name
undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit
Protein Entry
ARNF_ECOLI
UniProt ID
P76474
Species
E. coli

Comments

Comment Type Description
Disruption Phenotype Cells lacking this gene are polymyxin sensitive. Lipid A is no longer modified with L-Ara4N even though the level of the lipid-linked donor of the L-Ara4N moiety, alpha- L-Ara4N-phosphoundecaprenol, is not reduced. However, the alpha-L- Ara4N-phosphoundecaprenol is less concentrated on the periplasmic surface of the inner membrane when compared to wild type. {ECO:0000269|PubMed:17928292}.
Function Translocates 4-amino-4-deoxy-L-arabinose- phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane. {ECO:0000269|PubMed:17928292}.
Induction Induced by BasR. {ECO:0000269|PubMed:15569938}.
Pathway Bacterial outer membrane biogenesis; lipopolysaccharide biosynthesis.
Sequence Caution Sequence=AAB04894.1; Type=Frameshift; Positions=128; Evidence={ECO:0000305};
Similarity Belongs to the ArnF family. {ECO:0000305}.
Subcellular Location Cell inner membrane; Multi-pass membrane protein.
Subunit Heterodimer of ArnE and ArnF. {ECO:0000305|PubMed:17928292}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007678 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
90111409 RefSeq NP_416761 128 undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007678 proteins

Reference Database Accession Length Protein Name
GI:90111409 GenBank KHI19749.1 128 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase [Escherichia coli]
GI:90111409 GenBank KHI34397.1 128 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase [Escherichia coli]
GI:90111409 GenBank KHI44394.1 128 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase [Escherichia coli]
GI:90111409 GenBank KHI60751.1 128 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase [Escherichia coli]
GI:90111409 GenBank KHJ24272.1 128 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase [Escherichia coli]
GI:90111409 gnl IGS 128 undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit [Escherichia coli ER2796]

Related Sequences to LMP007678 proteins

Reference Database Accession Length Protein Name
GI:90111409 GenBank EFF06179.1 222 polymyxin resistance protein PmrM [Escherichia coli B185]
GI:90111409 GenBank EIG70082.1 222 hypothetical protein ESBG_00353 [Escherichia sp. 4_1_40B]
GI:90111409 GenBank EQZ65911.1 128 undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF [Escherichia coli UMEA 3671-1]
GI:90111409 GenBank ESM37716.1 128 undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF [Escherichia coli BWH 32]
GI:90111409 gnl mgcchina 222 putative transport/receptor protein [Shigella sonnei Ss046]
GI:90111409 RefSeq WP_000523881.1 128 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase subunit F [Escherichia coli]