Gene/Proteome Database (LMPD)

LMPD ID
LMP007660
Gene ID
945775
Species
Escherichia coli K-12 (E. coli)
Gene Name
lipoprotein localization factor
Gene Symbol
lolB
Synonyms
ECK1197; JW1200; hemM; ychC
Summary
First 21 aa are a type II signal peptide. [More information is available at EcoGene: EG11293]. LolB is an outer membrane lipoprotein which is generally required for LolA-dependent localization of lipoproteins (including LolB itself) to the outer membrane . [More information is available at EcoCyc: EG11293].
Orthologs
View orthologs and multiple alignments for lolB

Proteins

lipoprotein localization factor [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415727
Protein GI 16129172
UniProt ID P61320
Length 207
RefSeq Status REVIEWED
MPLPDFRLIRLLPLAALVLTACSVTTPKGPGKSPDSPQWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRYRLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEITYSQNGKNWKVVYGGYDTKTQPAMPANMELTDGGQRIKLKMDNWIVK

Gene Information

Entrez Gene ID
945775
Gene Name
lipoprotein localization factor
Gene Symbol
lolB
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009279 IDA:EcoCyc C cell outer membrane
GO:0071723 IDA:EcoCyc F lipopeptide binding
GO:0008565 IEA:UniProtKB-HAMAP F protein transporter activity
GO:0010876 IDA:EcoCyc P lipid localization
GO:0042157 IMP:EcoCyc P lipoprotein metabolic process
GO:0051668 IDA:EcoCyc P localization within membrane

Domain Information

InterPro Annotations

Accession Description
IPR029046 LolA/LolB/LppX
IPR004565 OM_lipoprot_LolB

UniProt Annotations

Entry Information

Gene Name
lipoprotein localization factor
Protein Entry
LOLB_ECOLI
UniProt ID
P61320
Species
E. coli

Comments

Comment Type Description
Caution Was originally thought to be involved in delta- aminolevulinic acid biosynthesis. {ECO:0000305|PubMed:1427085}.
Function Plays a critical role in the incorporation of lipoproteins in the outer membrane after they are released by the LolA protein. Essential for E.coli viability.
Similarity Belongs to the LolB family. {ECO:0000305}.
Subcellular Location Cell outer membrane; Lipid-anchor.
Subunit Monomer.

Identical and Related Proteins

Unique RefSeq proteins for LMP007660 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16129172 RefSeq NP_415727 207 lipoprotein localization factor [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007660 proteins

Reference Database Accession Length Protein Name
GI:16129172 GenBank KHJ06650.1 207 outer membrane lipoprotein LolB [Escherichia coli]
GI:16129172 GenBank KHJ13609.1 207 outer membrane lipoprotein LolB [Escherichia coli]
GI:16129172 GenBank KHJ23572.1 207 outer membrane lipoprotein LolB [Escherichia coli]
GI:16129172 GenBank KHJ27324.1 207 outer membrane lipoprotein LolB [Escherichia coli]
GI:16129172 GenBank KHJ28773.1 207 outer membrane lipoprotein LolB [Escherichia coli]
GI:16129172 gnl IGS 207 lipoprotein localization factor [Escherichia coli ER2796]

Related Sequences to LMP007660 proteins

Reference Database Accession Length Protein Name
GI:16129172 GenBank EGI17406.1 229 outer membrane lipoprotein LolB [Escherichia coli M605]
GI:16129172 GenBank KEO35311.1 207 outer membrane lipoprotein LolB [Escherichia coli 1-250-04_S3_C2]
GI:16129172 gnl jgi 229 outer membrane lipoprotein LolB [Escherichia coli KO11FL]
GI:16129172 RefSeq YP_005278308.1 229 outer membrane lipoprotein LolB [Escherichia coli KO11FL]
GI:16129172 RefSeq WP_015695617.1 229 outer membrane lipoprotein LolB [Escherichia coli]
GI:16129172 RefSeq WP_023307921.1 207 outer-membrane lipoprotein lolB [Escherichia coli]