Gene/Proteome Database (LMPD)

LMPD ID
LMP007657
Gene ID
945261
Species
Escherichia coli K-12 (E. coli)
Gene Name
2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol oxygenase
Gene Symbol
ubiF
Synonyms
ECK0654; JW0659; yleB
Summary
visC, ubiH, ubiF and mhpA are paralogs. [More information is available at EcoGene: EG13658]. 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinone hydroxylase catalyzes the third monooxygenase reaction in the ubiquinone biosynthesis pathway. [More information is available at EcoCyc: G6365].
Orthologs
View orthologs and multiple alignments for ubiF

Proteins

2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol oxygenase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415195
Protein GI 16128645
UniProt ID P75728
Length 391
RefSeq Status REVIEWED
MTNQPTEIAIVGGGMVGGALALGLAQHGFAVTVIEHAEPAPFVADSQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPLLGYMVENTVLQQALWQALEAHPKVTLRVPGSLIALHRHDDLQELELKGGEVIRAKLVIGADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNWASLVWYDSPARIRQLQNMNMAQLQAEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQPGLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMADNFIMQSGMDLFYAGFSNNLPPLRFMRNLGLMAAERAGVLKRQALKYALGL

Gene Information

Entrez Gene ID
945261
Gene Name
2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol oxygenase
Gene Symbol
ubiF
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008682 IMP:EcoliWiki F 2-octoprenyl-3-methyl-6-methoxy-1,4-benzoquinone hydroxylase activity
GO:0050660 IEA:InterPro F flavin adenine dinucleotide binding
GO:0016705 ISS:EcoCyc F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016709 IEA:InterPro F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0006744 IMP:EcoCyc P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco01110 Biosynthesis of secondary metabolites
eco01100 Metabolic pathways
eco00130 Ubiquinone and other terpenoid-quinone biosynthesis
ko00130 Ubiquinone and other terpenoid-quinone biosynthesis
M00117 Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
eco_M00117 Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone

BIOCYC Pathway Links

BIOCYC Pathway ID Description
ALL-CHORISMATE-PWY superpathway of chorismate metabolism
ALL-CHORISMATE-PWY superpathway of chorismate metabolism
UBISYN-PWY superpathway of ubiquinol-8 biosynthesis (prokaryotic)
UBISYN-PWY superpathway of ubiquinol-8 biosynthesis (prokaryotic)
PWY-6708 ubiquinol-8 biosynthesis (prokaryotic)
PWY-6708 ubiquinol-8 biosynthesis (prokaryotic)

Domain Information

InterPro Annotations

Accession Description
IPR003042 Aromatic-ring hydroxylase-like
IPR002938 Monooxygenase, FAD-binding
IPR010971 Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/UbiI/COQ6
IPR018168 Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6, conserved site

UniProt Annotations

Entry Information

Gene Name
2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol oxygenase
Protein Entry
UBIF_ECOLI
UniProt ID
P75728
Species
E. coli

Comments

Comment Type Description
Cofactor Name=FAD; Xref=ChEBI:CHEBI:57692; Evidence={ECO:0000305};
Function Oxygenase that introduces the hydroxyl group at carbon five of 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol resulting in the formation of 2-octaprenyl-3-methyl-5-hydroxy-6-methoxy-1,4- benzoquinol.
Interaction P75680:insO1; NbExp=3; IntAct=EBI-562588, EBI-9152908;
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Similarity Belongs to the UbiH/COQ6 family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007657 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16128645 RefSeq NP_415195 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol oxygenase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007657 proteins

Reference Database Accession Length Protein Name
GI:16128645 GenBank KHH92901.1 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [Escherichia coli]
GI:16128645 GenBank KHI12684.1 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [Escherichia coli]
GI:16128645 GenBank KHI18759.1 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [Escherichia coli]
GI:16128645 GenBank KHI56368.1 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [Escherichia coli]
GI:16128645 GenBank KHI87904.1 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [Escherichia coli]
GI:16128645 gnl IGS 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol oxygenase [Escherichia coli ER2796]

Related Sequences to LMP007657 proteins

Reference Database Accession Length Protein Name
GI:16128645 EMBL CAQ31138.1 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinone hydroxylase [Escherichia coli BL21(DE3)]
GI:16128645 GenBank ACT42506.1 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [Escherichia coli BL21(DE3)]
GI:16128645 gnl jgi 391 Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
GI:16128645 gnl REF_jgi 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
GI:16128645 gnl kribb 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [Escherichia coli B str. REL606]
GI:16128645 RefSeq YP_002998467.1 391 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinone hydroxylase [Escherichia coli BL21(DE3)]