Gene/Proteome Database (LMPD)

LMPD ID
LMP007649
Gene ID
948989
Species
Escherichia coli K-12 (E. coli)
Gene Name
lipoprotein chaperone
Gene Symbol
lolA
Synonyms
ECK0882; JW0874; lplA; yzzV
Summary
Lipoproteins contain a fatty acyl chain covalently attached to the N-terminal cysteine residue. [More information is available at EcoCyc: G6465].
Orthologs
View orthologs and multiple alignments for lolA

Proteins

lipoprotein chaperone [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415411
Protein GI 145698236
UniProt ID P61316
Length 203
RefSeq Status REVIEWED
MKKIAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Gene Information

Entrez Gene ID
948989
Gene Name
lipoprotein chaperone
Gene Symbol
lolA
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030288 IDA:EcoCyc C outer membrane-bounded periplasmic space
GO:0042954 IDA:EcoCyc F lipoprotein transporter activity
GO:0042953 IDA:EcoCyc P lipoprotein transport

Domain Information

InterPro Annotations

Accession Description
IPR029046 LolA/LolB/LppX
IPR004564 OM_lipoprot_carrier_LolA-like
IPR018323 OM_lipoprot_carrier_LolA_Pbac

UniProt Annotations

Entry Information

Gene Name
lipoprotein chaperone
Protein Entry
LOLA_ECOLI
UniProt ID
P61316
Species
E. coli

Comments

Comment Type Description
Function May act as a regulator of the RCS-phosphorelay signal transduction pathway. {ECO:0000269|PubMed:11758943}.
Function Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane); the inner membrane retention signal functions at the release step. {ECO:0000269|PubMed:11758943}.
Interaction P69776:lpp; NbExp=1; IntAct=EBI-553532, EBI-909750;
Sequence Caution Sequence=BAA08390.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA35616.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the LolA family. {ECO:0000305}.
Subcellular Location Periplasm.
Subunit Monomer.

Identical and Related Proteins

Unique RefSeq proteins for LMP007649 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
145698236 RefSeq NP_415411 203 lipoprotein chaperone [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007649 proteins

Reference Database Accession Length Protein Name
GI:145698236 GenBank KHJ08847.1 203 lipoprotein chaperone [Escherichia coli]
GI:145698236 GenBank KHJ09696.1 203 lipoprotein chaperone [Escherichia coli]
GI:145698236 GenBank KHJ19625.1 203 lipoprotein chaperone [Escherichia coli]
GI:145698236 GenBank KHJ23678.1 203 lipoprotein chaperone [Escherichia coli]
GI:145698236 GenBank KHJ25191.1 203 lipoprotein chaperone [Escherichia coli]
GI:145698236 gnl IGS 203 lipoprotein chaperone [Escherichia coli ER2796]

Related Sequences to LMP007649 proteins

Reference Database Accession Length Protein Name
GI:145698236 GenBank EGI22246.1 204 outer membrane lipoprotein carrier protein LolA [Escherichia coli M718]
GI:145698236 GenBank EGI46665.1 204 outer membrane lipoprotein carrier protein LolA [Escherichia coli H591]
GI:145698236 GenBank EGJ07904.1 204 outer membrane lipoprotein carrier protein LolA [Escherichia coli D9]
GI:145698236 GenBank EGT67082.1 204 hypothetical protein C22711_1110 [Escherichia coli O104:H4 str. C227-11]
GI:145698236 gnl vmpmisu 204 Outer-membrane lipoprotein carrier protein precursor [Escherichia coli APEC O1]
GI:145698236 gnl REF_vmpmisu 204 outer-membrane lipoprotein carrier protein [Escherichia coli APEC O1]