Gene/Proteome Database (LMPD)

LMPD ID
LMP007642
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
putative colanic acid exporter
Gene Symbol
Synonyms
ECK2040; JW2031; wzx
Summary
Wzx is an uncharacterized member of the Polysaccharide Transporter (PST) family . [More information is available at EcoCyc: G7097].
Orthologs

Proteins

putative colanic acid exporter [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_416550
Protein GI 16129986
UniProt ID P77377
Length 492
RefSeq Status REVIEWED
MSLREKTISGAKWSAIATVIIIGLGLVQMTVLARIIDNHQFGLLTVSLVIIALADTLSDFGIANSIIQRKEISHLELTTLYWLNVGLGIVVCVAVFLLSDLIGDVLNNPDLAPLIKTLSLAFVVIPHGQQFRALMQKELEFNKIGMIETSAVLAGFTCTVVSAHFWPLAMTAILGYLVNSAVRTLLFGYFGRKIYRPGLHFSLASVAPNLRFGAWLTADSIINYLNTNLSTLVLARILGAGVAGGYNLAYNVAVVPPMKLNPIITRVLFPAFAKIQDDTEKLRVNFYKLLSVVGIINFPALLGLMVVSNNFVPLVFGEKWNSIIPVLQLLCVVGLLRSVGNPIGSLLMAKARVDISFKFNVFKTFLFIPAIVIGGQMAGAIGVTLGFLLVQIINTILSYFVMIKPVLGSSYRQYILSLWLPFYLSLPTLVVSYALGIVLKGQLALGMLLAVQIATGVLAFVVMIVLSRHPLVVEVKRQFCRSEKMKMLLRAG

Gene Information

Entrez Gene ID
Gene Name
putative colanic acid exporter
Gene Symbol
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0009103 IEA:UniProtKB-UniPathway P lipopolysaccharide biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR002797 Polysacc_synth

UniProt Annotations

Entry Information

Gene Name
putative colanic acid exporter
Protein Entry
WZXC_ECOLI
UniProt ID
Species
E. coli

Comments

Comment Type Description
Pathway Bacterial outer membrane biogenesis; lipopolysaccharide biosynthesis.
Similarity Belongs to the polysaccharide synthase family. {ECO:0000305}.
Subcellular Location Cell inner membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP007642 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16129986 RefSeq NP_416550 492 putative colanic acid exporter [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007642 proteins

Reference Database Accession Length Protein Name
GI:16129986 EMBL CDY59352.1 492 WzxC [Escherichia coli]
GI:16129986 EMBL CDZ20867.1 492 WzxC [Escherichia coli]
GI:16129986 GenBank KGA85590.1 492 colanic acid exporter [Escherichia coli]
GI:16129986 GenBank KGL68986.1 492 colanic acid exporter [Escherichia coli NCTC 50110]
GI:16129986 gnl PRJNA257976 492 putative colanic acid exporter [Escherichia coli BW25113]
GI:16129986 gnl IGS 492 putative colanic acid exporter [Escherichia coli ER2796]

Related Sequences to LMP007642 proteins

Reference Database Accession Length Protein Name
GI:16129986 GenBank ENF62054.1 492 lipopolysaccharide biosynthesis protein wzxC [Escherichia coli P0304816.7]
GI:16129986 GenBank ENF68215.1 492 lipopolysaccharide biosynthesis protein wzxC [Escherichia coli P0304816.8]
GI:16129986 GenBank ENF71410.1 492 lipopolysaccharide biosynthesis protein wzxC [Escherichia coli P0304816.9]
GI:16129986 GenBank ENH32665.1 492 lipopolysaccharide biosynthesis protein wzxC [Escherichia coli P0304816.3]
GI:16129986 GenBank KEL28728.1 492 lipopolysaccharide biosynthesis protein wzxC [Escherichia coli 3-373-03_S4_C3]
GI:16129986 RefSeq WP_032242436.1 492 colanic acid exporter [Escherichia coli]