Gene/Proteome Database (LMPD)

LMPD ID
LMP007631
Gene ID
945057
Species
Escherichia coli K-12 (E. coli)
Gene Name
2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Gene Symbol
ispF
Synonyms
ECK2741; JW2716; ygbB
Summary
2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (IspF) catalyzes the fifth step in the methylerythritol phosphate pathway. [More information is available at EcoCyc: EG11816].
Orthologs
View orthologs and multiple alignments for ispF

Proteins

2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_417226
Protein GI 16130653
UniProt ID P62617
Length 159
RefSeq Status REVIEWED
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK

Gene Information

Entrez Gene ID
945057
Gene Name
2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Gene Symbol
ispF
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008685 IDA:EcoCyc F 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity
GO:0042802 IDA:EcoCyc F identical protein binding
GO:0030145 IDA:EcoCyc F manganese ion binding
GO:0046872 IDA:EcoCyc F metal ion binding
GO:0008270 IDA:EcoCyc F zinc ion binding
GO:0019288 IEA:UniProtKB-UniPathway P isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
GO:0016114 IEA:UniProtKB-HAMAP P terpenoid biosynthetic process
GO:0006744 IDA:EcoCyc P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco01110 Biosynthesis of secondary metabolites
M00096 C5 isoprenoid biosynthesis, non-mevalonate pathway
eco_M00096 C5 isoprenoid biosynthesis, non-mevalonate pathway
eco01100 Metabolic pathways
eco00900 Terpenoid backbone biosynthesis
ko00900 Terpenoid backbone biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
NONMEVIPP-PWY methylerythritol phosphate pathway
NONMEVIPP-PWY methylerythritol phosphate pathway
PWY-5121 superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP)
PWY-7392 taxadiene biosynthesis (engineered)

Domain Information

InterPro Annotations

Accession Description
IPR003526 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
IPR020555 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, conserved site

UniProt Annotations

Entry Information

Gene Name
2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Protein Entry
ISPF_ECOLI
UniProt ID
P62617
Species
E. coli

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=339 uM for CDP-ME2P (at pH 7.4) {ECO:0000269|PubMed:22839733}; Note=kcat is 61 min(-1) for CDP-ME2P (at pH 7.4).;
Catalytic Activity 2-phospho-4-(cytidine 5'-diphospho)-2-C- methyl-D-erythritol = 2-C-methyl-D-erythritol 2,4-cyclodiphosphate + CMP. {ECO:0000269|PubMed:10694574, ECO:0000269|PubMed:22839733}.
Cofactor Name=a divalent metal cation; Xref=ChEBI:CHEBI:60240; Evidence={ECO:0000269|PubMed:10694574, ECO:0000269|PubMed:11786530, ECO:0000269|PubMed:11829504, ECO:0000269|PubMed:11997478, ECO:0000269|PubMed:15608374, ECO:0000269|PubMed:16392111, ECO:0000269|PubMed:16511114, ECO:0000269|PubMed:19320487}; Note=Binds 1 divalent metal cation per subunit. {ECO:0000269|PubMed:10694574, ECO:0000269|PubMed:11786530, ECO:0000269|PubMed:11829504, ECO:0000269|PubMed:11997478, ECO:0000269|PubMed:15608374, ECO:0000269|PubMed:16392111, ECO:0000269|PubMed:16511114, ECO:0000269|PubMed:19320487};
Disruption Phenotype Cells lacking this gene reveal a filamentous phenotype. {ECO:0000269|PubMed:12270818}.
Enzyme Regulation Activated by 2C-methyl-D-erythritol 4-phosphate (MEP). {ECO:0000269|PubMed:22839733}.
Function Involved in the biosynthesis of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), two major building blocks of isoprenoid compounds. Catalyzes the conversion of 4- diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP). Also converts 4-diphosphocytidyl-2-C-methyl-D-erythritol into 2-C- methyl-D-erythritol 3,4-cyclophosphate and CMP. {ECO:0000269|PubMed:10694574, ECO:0000269|PubMed:22839733}.
Interaction P67910:hldD; NbExp=1; IntAct=EBI-562321, EBI-543760;
Pathway Isoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via DXP pathway; isopentenyl diphosphate from 1- deoxy-D-xylulose 5-phosphate: step 4/6.
Similarity Belongs to the IspF family. {ECO:0000305}.
Subunit Homotrimer. {ECO:0000269|PubMed:11786530, ECO:0000269|PubMed:11829504, ECO:0000269|PubMed:11997478, ECO:0000269|PubMed:15608374, ECO:0000269|PubMed:16392111, ECO:0000269|PubMed:16511114, ECO:0000269|PubMed:19320487}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007631 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16130653 RefSeq NP_417226 159 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007631 proteins

Reference Database Accession Length Protein Name
GI:16130653 GenBank KHJ04846.1 159 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Escherichia coli]
GI:16130653 GenBank KHJ12320.1 159 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Escherichia coli]
GI:16130653 GenBank KHJ16624.1 159 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Escherichia coli]
GI:16130653 GenBank KHJ27775.1 159 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Escherichia coli]
GI:16130653 GenBank KHJ29324.1 159 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Escherichia coli]
GI:16130653 gnl IGS 159 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Escherichia coli ER2796]

Related Sequences to LMP007631 proteins

Reference Database Accession Length Protein Name
GI:16130653 PDB 1H47 161 Chain A, Structures Of Mecp Synthase In Complex With (I) Cmp And (Ii) Cmp And Product
GI:16130653 PDB 1H47 161 Chain B, Structures Of Mecp Synthase In Complex With (I) Cmp And (Ii) Cmp And Product
GI:16130653 PDB 1H47 161 Chain C, Structures Of Mecp Synthase In Complex With (I) Cmp And (Ii) Cmp And Product
GI:16130653 PDB 1H47 161 Chain D, Structures Of Mecp Synthase In Complex With (I) Cmp And (Ii) Cmp And Product
GI:16130653 PDB 1H47 161 Chain E, Structures Of Mecp Synthase In Complex With (I) Cmp And (Ii) Cmp And Product
GI:16130653 PDB 1H47 161 Chain F, Structures Of Mecp Synthase In Complex With (I) Cmp And (Ii) Cmp And Product