Gene/Proteome Database (LMPD)
LMPD ID
LMP007610
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
long-chain fatty acid outer membrane transporter
Gene Symbol
Synonyms
ECK2338; JW2341; ttr
Summary
FadL is an outer membrane protein involved with the uptake of long-chain fatty acids . [More information is available at EcoCyc: EG10280].
Orthologs
Proteins
| long-chain fatty acid outer membrane transporter [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_416846 |
| Protein GI | 145698292 |
| UniProt ID | P10384 |
| Length | 446 |
| RefSeq Status | REVIEWED |
| MSQKTLFTKSALAVAVALISTQAWSAGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF | |
Gene Information
Entrez Gene ID
Gene Name
long-chain fatty acid outer membrane transporter
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009279 | IEA:UniProtKB-KW | C | cell outer membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0015909 | IMP:EcoCyc | P | long-chain fatty acid transport |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005017 | Toluene_X |
UniProt Annotations
Entry Information
Gene Name
long-chain fatty acid outer membrane transporter
Protein Entry
FADL_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Function | Involved in translocation of long-chain fatty acids across the outer membrane. It is a receptor for the bacteriophage T2. FadL may form a specific channel. |
| Induction | By long-chain fatty acids. Expression of fadL is under the control of the FadR repressor. |
| Sequence Caution | Sequence=AAA64433.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA16205.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAA68630.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
| Similarity | Belongs to the OmpP1/FadL family. {ECO:0000305}. |
| Subcellular Location | Cell outer membrane {ECO:0000269|PubMed:16079137}; Multi-pass membrane protein {ECO:0000269|PubMed:16079137}. |
| Subunit | Has been isolated from outer membrane preparation as a homodimer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007610 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 145698292 | RefSeq | NP_416846 | 446 | long-chain fatty acid outer membrane transporter [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007610 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145698292 | GenBank | KHH89811.1 | 446 | long-chain fatty acid outer membrane transporter [Escherichia coli] |
| GI:145698292 | GenBank | KHI21513.1 | 446 | long-chain fatty acid outer membrane transporter [Escherichia coli] |
| GI:145698292 | GenBank | KHI44316.1 | 446 | long-chain fatty acid outer membrane transporter [Escherichia coli] |
| GI:145698292 | GenBank | KHI60666.1 | 446 | long-chain fatty acid outer membrane transporter [Escherichia coli] |
| GI:145698292 | GenBank | KHI96147.1 | 446 | long-chain fatty acid outer membrane transporter [Escherichia coli] |
| GI:145698292 | gnl | IGS | 446 | long-chain fatty acid outer membrane transporter [Escherichia coli ER2796] |
Related Sequences to LMP007610 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145698292 | EMBL | CBJ01983.1 | 448 | long-chain fatty acid transport protein [Escherichia coli ETEC H10407] |
| GI:145698292 | EMBL | CDY60047.1 | 448 | long-chain fatty acid outer membrane porin; bacteriophage T2 binding [Escherichia coli] |
| GI:145698292 | EMBL | CDZ21166.1 | 448 | long-chain fatty acid outer membrane porin; bacteriophage T2 binding [Escherichia coli] |
| GI:145698292 | GenBank | EFP99225.1 | 448 | long-chain fatty acid outer membrane transporter [Escherichia coli 1827-70] |
| GI:145698292 | GenBank | KGL70945.1 | 448 | long-chain fatty acid outer membrane transporter [Escherichia coli NCTC 50110] |
| GI:145698292 | RefSeq | YP_007557528.1 | 448 | long-chain fatty acid outer membrane transporter [Escherichia coli str. K-12 substr. MDS42] |