Gene/Proteome Database (LMPD)

LMPD ID
LMP007580
Gene ID
945064
Species
Escherichia coli K-12 (E. coli)
Gene Name
geranyltranstransferase
Gene Symbol
ispA
Synonyms
ECK0415; JW0411
Summary
Farnesyl diphosphate synthase can utilize both dimethylallyl and geranyl diphosphates as substrates, generating geranyl and farnesyl diphosphate, respectively. [More information is available at EcoCyc: EG10508].
Orthologs
View orthologs and multiple alignments for ispA

Proteins

geranyltranstransferase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_414955
Protein GI 16128406
UniProt ID P22939
Length 299
RefSeq Status REVIEWED
MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTLAFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDDARQSLKQLAEQSLDTSALEALADYIIQRNK

Gene Information

Entrez Gene ID
945064
Gene Name
geranyltranstransferase
Gene Symbol
ispA
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0004161 IDA:EcoCyc F dimethylallyltranstransferase activity
GO:0004337 IDA:EcoCyc F geranyltranstransferase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0045337 IMP:EcoCyc P farnesyl diphosphate biosynthetic process
GO:0033384 IMP:EcoCyc P geranyl diphosphate biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco01110 Biosynthesis of secondary metabolites
M00364 C10-C20 isoprenoid biosynthesis, bacteria
eco_M00364 C10-C20 isoprenoid biosynthesis, bacteria
eco01100 Metabolic pathways
eco00900 Terpenoid backbone biosynthesis
ko00900 Terpenoid backbone biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-7102 bisabolene biosynthesis
PWY-5122 geranyl diphosphate biosynthesis
POLYISOPRENSYN-PWY polyisoprenoid biosynthesis (E. coli)
POLYISOPRENSYN-PWY polyisoprenoid biosynthesis (E. coli)
PWY-5121 superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP)
PWY-7392 taxadiene biosynthesis (engineered)
PWY-5123 trans, trans-farnesyl diphosphate biosynthesis
PWY-5123 trans, trans-farnesyl diphosphate biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR008949 Isoprenoid synthase domain
IPR000092 Polyprenyl synthetase
IPR017446 Polyprenyl synthetase-related

UniProt Annotations

Entry Information

Gene Name
geranyltranstransferase
Protein Entry
ISPA_ECOLI
UniProt ID
P22939
Species
E. coli

Comments

Comment Type Description
Catalytic Activity Geranyl diphosphate + isopentenyl diphosphate = diphosphate + (2E,6E)-farnesyl diphosphate.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:14672944}; Note=Binds 3 Mg(2+) ions per subunit. {ECO:0000269|PubMed:14672944};
Interaction P77609:flxA; NbExp=5; IntAct=EBI-553011, EBI-553024; P33221:purT; NbExp=3; IntAct=EBI-553011, EBI-553029;
Similarity Belongs to the FPP/GGPP synthase family. {ECO:0000305}.
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP007580 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16128406 RefSeq NP_414955 299 geranyltranstransferase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007580 proteins

Reference Database Accession Length Protein Name
GI:16128406 GenBank KHI84717.1 299 geranyl transferase [Escherichia coli]
GI:16128406 GenBank KHI94225.1 299 geranyl transferase [Escherichia coli]
GI:16128406 GenBank KHJ15708.1 299 geranyl transferase [Escherichia coli]
GI:16128406 GenBank KHJ22561.1 299 geranyl transferase [Escherichia coli]
GI:16128406 GenBank KHJ27916.1 299 geranyl transferase [Escherichia coli]
GI:16128406 gnl IGS 299 geranyltranstransferase [Escherichia coli ER2796]

Related Sequences to LMP007580 proteins

Reference Database Accession Length Protein Name
GI:16128406 GenBank ACW22974.1 314 Sequence 1 from patent US 7563610
GI:16128406 GenBank ENB21281.1 299 farnesyl diphosphate synthase [Escherichia coli BCE008_MS-01]
GI:16128406 PDB 1RQI 300 Chain A, Active Conformation Of Farnesyl Pyrophosphate Synthase Bound To Isopentyl Pyrophosphate And Dimethylallyl S- Thiolodiphosphate
GI:16128406 PDB 1RQI 300 Chain B, Active Conformation Of Farnesyl Pyrophosphate Synthase Bound To Isopentyl Pyrophosphate And Dimethylallyl S- Thiolodiphosphate
GI:16128406 RefSeq WP_000347239.1 299 MULTISPECIES: geranyltranstransferase [Shigella]
GI:16128406 RefSeq WP_001408463.1 299 farnesyl diphosphate synthase [Escherichia coli]