Gene/Proteome Database (LMPD)

LMPD ID
LMP007553
Gene ID
947542
Species
Escherichia coli K-12 (E. coli)
Gene Name
phosphatidylglycerophosphatase A
Gene Symbol
pgpA
Synonyms
ECK0412; JW0408; yajN
Summary
The pgpA gene is nonessential. [More information is available at EcoGene: EG10704].
Orthologs
View orthologs and multiple alignments for pgpA

Proteins

phosphatidylglycerophosphatase A [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_414952
Protein GI 16128403
UniProt ID P18200
Length 172
RefSeq Status REVIEWED
MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAAIPFWYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPTNDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIGHHWPLGILS

Gene Information

Entrez Gene ID
947542
Gene Name
phosphatidylglycerophosphatase A
Gene Symbol
pgpA
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005887 TAS:EcoCyc C integral component of plasma membrane
GO:0005886 IDA:UniProtKB C plasma membrane
GO:0042577 IDA:UniProtKB F lipid phosphatase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0008962 IDA:UniProtKB F phosphatidylglycerophosphatase activity
GO:0046474 IMP:EcoCyc P glycerophospholipid biosynthetic process
GO:0006655 IDA:UniProtKB P phosphatidylglycerol biosynthetic process
GO:0009395 IEA:UniProtKB-KW P phospholipid catabolic process
GO:0046839 IDA:UniProtKB P phospholipid dephosphorylation
GO:0032026 IDA:UniProtKB P response to magnesium ion

KEGG Pathway Links

KEGG Pathway ID Description
eco00564 Glycerophospholipid metabolism
ko00564 Glycerophospholipid metabolism
eco01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5668 cardiolipin biosynthesis I
PWY-5668 cardiolipin biosynthesis I
PWY-5668 cardiolipin biosynthesis I
PWY0-1545 cardiolipin biosynthesis III
PWY0-1545 cardiolipin biosynthesis III
PWY4FS-7 phosphatidylglycerol biosynthesis I (plastidic)
PWY4FS-8 phosphatidylglycerol biosynthesis II (non-plastidic)
PHOSLIPSYN-PWY phospholipid biosynthesis I
PHOSLIPSYN-PWY phospholipid biosynthesis I
PHOSLIPSYN-PWY phospholipid biosynthesis I

Domain Information

InterPro Annotations

Accession Description
IPR026037 PgpA
IPR007686 YutG/PgpA

UniProt Annotations

Entry Information

Gene Name
phosphatidylglycerophosphatase A
Protein Entry
PGPA_ECOLI
UniProt ID
P18200
Species
E. coli

Comments

Comment Type Description
Catalytic Activity Phosphatidylglycerophosphate + H(2)O = phosphatidylglycerol + phosphate. {ECO:0000269|PubMed:20485265, ECO:0000269|PubMed:21148555, ECO:0000269|PubMed:2846510, ECO:0000269|PubMed:6296050}.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:21148555};
Disruption Phenotype Displays 7-10 fold higher levels of phosphatidylglycerophosphate (PGP) than wild-type. Simultaneous deletion of pgpA and pgpB leads to 40 times higher PGP levels compared to wild-type, while simultaneous deletion of pgpA and pgpC leads to almost 100 times higher PGP levels. Lethal when combined with the deletion of both pgpB and pgpC. {ECO:0000269|PubMed:21148555, ECO:0000269|PubMed:2846510, ECO:0000269|PubMed:6296050}.
Function Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG). {ECO:0000269|PubMed:20485265, ECO:0000269|PubMed:21148555, ECO:0000269|PubMed:2846510, ECO:0000269|PubMed:6296050}.
Pathway Phospholipid metabolism; phosphatidylglycerol biosynthesis; phosphatidylglycerol from CDP-diacylglycerol: step 2/2.
Sequence Caution Sequence=AAA24325.1; Type=Frameshift; Positions=42; Note=In addition, due to translation of the incorrect DNA strand, an unrelated ORF was predicted.; Evidence={ECO:0000305};
Subcellular Location Cell inner membrane {ECO:0000269|PubMed:21148555}; Multi-pass membrane protein {ECO:0000269|PubMed:21148555}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007553 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16128403 RefSeq NP_414952 172 phosphatidylglycerophosphatase A [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007553 proteins

Reference Database Accession Length Protein Name
GI:16128403 GenBank KHJ06462.1 172 phosphatidylglycerophosphatase [Escherichia coli]
GI:16128403 GenBank KHJ15705.1 172 phosphatidylglycerophosphatase [Escherichia coli]
GI:16128403 GenBank KHJ22564.1 172 phosphatidylglycerophosphatase [Escherichia coli]
GI:16128403 GenBank KHJ27645.1 172 phosphatidylglycerophosphatase [Escherichia coli]
GI:16128403 GenBank KHJ27913.1 172 phosphatidylglycerophosphatase [Escherichia coli]
GI:16128403 gnl IGS 172 phosphatidylglycerophosphatase A [Escherichia coli ER2796]

Related Sequences to LMP007553 proteins

Reference Database Accession Length Protein Name
GI:16128403 GenBank EGI47425.1 184 phosphatidylglycerophosphatase A [Escherichia coli H591]
GI:16128403 GenBank ELC11534.1 172 phosphatidylglycerophosphatase A [Escherichia coli KTE10]
GI:16128403 GenBank ERB05347.1 172 phosphatidylglycerophosphatase A [Escherichia coli KOEGE 3 (4a)]
GI:16128403 GenBank ESK03083.1 172 phosphatidylglycerophosphatase A [Escherichia coli HVH 50 (4-2593475)]
GI:16128403 GenBank KHH52342.1 172 phosphatidylglycerophosphatase [Escherichia coli]
GI:16128403 RefSeq WP_001514979.1 172 phosphatidylglycerophosphatase A [Escherichia coli]