Gene/Proteome Database (LMPD)

LMPD ID
LMP007549
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
propionyl-CoA:succinate CoA transferase
Gene Symbol
Synonyms
ECK2916; JW2887; ygfH
Summary
Part of a four gene operon encoding enzymes converting succinate to propionate. [More information is available at EcoGene: EG12973]. The ygfH-encoded enzyme is a CoA transferase. [More information is available at EcoCyc: G7517].
Orthologs

Proteins

propionyl-CoA:succinate CoA transferase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_417395
Protein GI 16130821
UniProt ID P52043
Length 492
RefSeq Status REVIEWED
METQWTRMTANEAAEIIQHNDMVAFSGFTPAGSPKALPTAIARRANEQHEAKKPYQIRLLTGASISAAADDVLSDADAVSWRAPYQTSSGLRKKINQGAVSFVDLHLSEVAQMVNYGFFGDIDVAVIEASALAPDGRVWLTSGIGNAPTWLLRAKKVIIELNHYHDPRVAELADIVIPGAPPRRNSVSIFHAMDRVGTRYVQIDPKKIVAVVETNLPDAGNMLDKQNPMCQQIADNVVTFLLQEMAHGRIPPEFLPLQSGVGNINNAVMARLGENPVIPPFMMYSEVLQESVVHLLETGKISGASASSLTISADSLRKIYDNMDYFASRIVLRPQEISNNPEIIRRLGVIALNVGLEFDIYGHANSTHVAGVDLMNGIGGSGDFERNAYLSIFMAPSIAKEGKISTVVPMCSHVDHSEHSVKVIITEQGIADLRGLSPLQRARTIIDNCAHPMYRDYLHRYLENAPGGHIHHDLSHVFDLHRNLIATGSMLG

Gene Information

Entrez Gene ID
Gene Name
propionyl-CoA:succinate CoA transferase
Gene Symbol
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043821 IDA:EcoCyc F propionyl-CoA:succinate CoA-transferase activity
GO:0006084 IEA:InterPro P acetyl-CoA metabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY0-43 conversion of succinate to propionate
PWY0-43 conversion of succinate to propionate
PWY0-43 conversion of succinate to propionate
PWY-5088 glutamate degradation VIII (to propionate)
P108-PWY pyruvate fermentation to propionate I

Domain Information

InterPro Annotations

Accession Description
IPR026888 AcetylCoA_hyd_C
IPR003702 ActCoA_hydro
IPR017821 Succinate_CoA_transferase

UniProt Annotations

Entry Information

Gene Name
propionyl-CoA:succinate CoA transferase
Protein Entry
SCPC_ECOLI
UniProt ID
Species
E. coli

Comments

Comment Type Description
Catalytic Activity Propanoyl-CoA + succinate = propionate + succinyl-CoA. {ECO:0000269|PubMed:10769117}.
Function Catalyzes the transfer of coenzyme A from propionyl-CoA to succinate. Could be part of a pathway that converts succinate to propionate. {ECO:0000269|PubMed:10769117}.
Similarity Belongs to the acetyl-CoA hydrolase/transferase family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007549 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16130821 RefSeq NP_417395 492 propionyl-CoA:succinate CoA transferase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007549 proteins

Reference Database Accession Length Protein Name
GI:16130821 GenBank KHH67260.1 492 acetyl-CoA hydrolase [Escherichia coli]
GI:16130821 GenBank KHH95704.1 492 acetyl-CoA hydrolase [Escherichia coli]
GI:16130821 GenBank KHI14501.1 492 acetyl-CoA hydrolase [Escherichia coli]
GI:16130821 GenBank KHI24238.1 492 acetyl-CoA hydrolase [Escherichia coli]
GI:16130821 GenBank KHI62543.1 492 acetyl-CoA hydrolase [Escherichia coli]
GI:16130821 gnl IGS 492 propionyl-CoA:succinate CoA transferase [Escherichia coli ER2796]

Related Sequences to LMP007549 proteins

Reference Database Accession Length Protein Name
GI:16130821 DBBJ BAJ44677.1 492 propionyl-CoA:succinate-CoA transferase [Escherichia coli DH1]
GI:16130821 GenBank KGA87263.1 492 acetyl-CoA hydrolase [Escherichia coli]
GI:16130821 gnl jgi 492 succinate CoA transferase [Escherichia coli DH1]
GI:16130821 RefSeq YP_006090746.1 492 succinate CoA transferase [Escherichia coli DH1]
GI:16130821 RefSeq YP_006130222.1 492 propionyl-CoA:succinate-CoA transferase [Escherichia coli DH1]
GI:16130821 RefSeq WP_000449964.1 492 acetyl-CoA hydrolase [Escherichia coli]