Gene/Proteome Database (LMPD)

LMPD ID
LMP007546
Gene ID
947959
Species
Escherichia coli K-12 (E. coli)
Gene Name
sn-glycerol-3-phosphate ABC transporter permease
Gene Symbol
ugpE
Synonyms
ECK3435; JW3416
Summary
Pho regulon. [More information is available at EcoGene: EG11049]. The UgpABCE glycerol-3-phosphate uptake system is a member of the ATP-Binding Cassette (ABC) Superfamily . [More information is available at EcoCyc: EG11049].
Orthologs
View orthologs and multiple alignments for ugpE

Proteins

sn-glycerol-3-phosphate ABC transporter permease [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_417908
Protein GI 16131323
UniProt ID P10906
Length 281
RefSeq Status REVIEWED
MIENRPWLTIFSHTMLILGIAVILFPLYVAFVAATLDKQAVYAAPMTLIPGTHLLENIHNIWVNGVGTNSAPFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFITLMLPVEVRIFPTVEVIANLQMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIATGEGTTEWNSVMVAMLLTLIPPVVIVLVMQRAFVRGLVDSEK

Gene Information

Entrez Gene ID
947959
Gene Name
sn-glycerol-3-phosphate ABC transporter permease
Gene Symbol
ugpE
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0055052 IDA:EcoCyc C ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:0015169 IMP:EcoCyc F glycerol-3-phosphate transmembrane transporter activity
GO:0001406 IDA:EcoCyc F glycerophosphodiester transmembrane transporter activity
GO:0015794 IMP:EcoCyc P glycerol-3-phosphate transport
GO:0001407 IDA:EcoCyc P glycerophosphodiester transport

KEGG Pathway Links

KEGG Pathway ID Description
eco02010 ABC transporters
ko02010 ABC transporters
M00198 Putative sn-glycerol-phosphate transport system
eco_M00198 Putative sn-glycerol-phosphate transport system

Domain Information

InterPro Annotations

Accession Description
IPR000515 MetI-like

UniProt Annotations

Entry Information

Gene Name
sn-glycerol-3-phosphate ABC transporter permease
Protein Entry
UGPE_ECOLI
UniProt ID
P10906
Species
E. coli

Comments

Comment Type Description
Function Part of the binding-protein-dependent transport system for sn-glycerol-3-phosphate; probably responsible for the translocation of the substrate across the membrane.
Similarity Belongs to the binding-protein-dependent transport system permease family. UgpAE subfamily. {ECO:0000305}.
Similarity Contains 1 ABC transmembrane type-1 domain. {ECO:0000255|PROSITE-ProRule:PRU00441}.
Subcellular Location Cell inner membrane {ECO:0000269|PubMed:15919996}; Multi-pass membrane protein {ECO:0000255|PROSITE-ProRule:PRU00441, ECO:0000269|PubMed:15919996}.
Subunit The complex is composed of two ATP-binding proteins (UgpC), two transmembrane proteins (UgpA and UgpE) and a solute- binding protein (UgpB). {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007546 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16131323 RefSeq NP_417908 281 sn-glycerol-3-phosphate ABC transporter permease [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007546 proteins

Reference Database Accession Length Protein Name
GI:16131323 EMBL CDY63444.1 281 glycerol-3-phosphate / glycerol-2-phosphate ABC transporter-putative membrane subunit, subunit of glycerol-3-P ABC transporter [Escherichia coli]
GI:16131323 EMBL CDZ22225.1 281 glycerol-3-phosphate / glycerol-2-phosphate ABC transporter-putative membrane subunit, subunit of glycerol-3-P ABC transporter [Escherichia coli]
GI:16131323 GenBank KGA83329.1 281 glycerol-3-phosphate transporter membrane protein [Escherichia coli]
GI:16131323 GenBank KGL68549.1 281 glycerol-3-phosphate transporter membrane protein [Escherichia coli NCTC 50110]
GI:16131323 gnl PRJNA257976 281 glycerol-3-phosphate transporter subunit [Escherichia coli BW25113]
GI:16131323 gnl IGS 281 glycerol-3-phosphate transporter subunit [Escherichia coli ER2796]

Related Sequences to LMP007546 proteins

Reference Database Accession Length Protein Name
GI:16131323 EMBL CAQ33770.1 281 ugpE, subunit of glycerol-3-P ABC transporter [Escherichia coli BL21(DE3)]
GI:16131323 EMBL CCJ46066.1 281 sn-glycerol 3-phosphate transport system, integral membrane protein [Escherichia coli]
GI:16131323 GenBank ACT45102.1 281 glycerol-3-phosphate transporter subunit [Escherichia coli BL21(DE3)]
GI:16131323 gnl kribb 281 glycerol-3-phosphate transporter subunit [Escherichia coli B str. REL606]
GI:16131323 gnl REF_kribb 281 glycerol-3-phosphate transporter membrane protein [Escherichia coli B str. REL606]
GI:16131323 RefSeq YP_003001003.1 281 ugpE, subunit of glycerol-3-P ABC transporter [Escherichia coli BL21(DE3)]