Gene/Proteome Database (LMPD)

LMPD ID
LMP007538
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
Vta1p
Gene Symbol
Synonyms
-
Alternate Names
Vta1p
Chromosome
XII

Proteins

Vta1p
Refseq ID NP_013282
Protein GI 6323210
UniProt ID Q06263
mRNA ID NM_001182068
Length 330
RefSeq Status PROVISIONAL
MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSLYNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIGSSDEKTLDYADFADDSEEIKDEDVDHQTSDLENNNNDKVEGLAPKDQTTSYEPVDEVPEFIDDADSVNEEEQTVDKNEDAITKDEQQVVKKEVDLTRPSAPSEPAAAEHKSYTKDELTKIMDRASKIEQIQKLAKYAISALNYEDLPTAKDELTKALDLLNSI

Gene Information

Entrez Gene ID
Gene Name
Vta1p
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0005771 IDA:SGD C multivesicular body
GO:0001671 IDA:SGD F ATPase activator activity
GO:0045324 IMP:SGD P late endosome to vacuole transport
GO:0032511 IGI:SGD P late endosome to vacuole transport via multivesicular body sorting pathway
GO:0006869 IEA:UniProtKB-KW P lipid transport
GO:0032781 IDA:GOC P positive regulation of ATPase activity
GO:0032461 IDA:SGD P positive regulation of protein oligomerization
GO:0015031 IEA:UniProtKB-KW P protein transport

KEGG Pathway Links

KEGG Pathway ID Description
ko04144 Endocytosis
sce04144 Endocytosis

Domain Information

InterPro Annotations

Accession Description
IPR023175 Vacuolar protein sorting-associate protein Vta1/Callose synthase, N-terminal domain

UniProt Annotations

Entry Information

Gene Name
Vta1p
Protein Entry
VTA1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Function Has a role in the formation of the multivesicular body (MVB). Required for the sorting of lipids to form intralumenal vesicles and for fluid-phase transport to the vacuole. Required for sorting the plasma membrane proteins STE2 and STE3 into the MVB. Acts a cofactor of VSP4, promotes the oligomerization of VPS4 and stimulates its ATPase activity by 6- to 8-fold. {ECO:0000269|PubMed:12953057, ECO:0000269|PubMed:14701806, ECO:0000269|PubMed:16505166, ECO:0000269|PubMed:16601096}.
Interaction P52917:VPS4; NbExp=7; IntAct=EBI-37098, EBI-20475;
Miscellaneous Present with 4400 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the VTA1 family. {ECO:0000305}.
Subcellular Location Cytoplasm. Endosome membrane; Peripheral membrane protein.
Subunit Homodimer (in cytoplasm). Interacts with VPS4; the interaction requires the dimeric structure of VTA1; 6 homodimers of VTA1 appear to associate with the dodecameric VSP4 complex; the interaction is ADP-dependent. Interacts with SNF7; the interaction requires DID2. Interacts with DID2. Interacts with VPS60; the interaction occurs at he endosomal membrane. {ECO:0000269|PubMed:12953057, ECO:0000269|PubMed:14701806, ECO:0000269|PubMed:15086794, ECO:0000269|PubMed:16505166, ECO:0000269|PubMed:16601096, ECO:0000269|PubMed:18032584, ECO:0000269|PubMed:18194651, ECO:0000269|PubMed:18194652, ECO:0000269|PubMed:18280501}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007538 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6323210 RefSeq NP_013282 330 Vta1p

Identical Sequences to LMP007538 proteins

Reference Database Accession Length Protein Name
GI:6323210 EMBL CAL48159.1 330 unnamed protein product [Saccharomyces cerevisiae]
GI:6323210 GenBank AAB67473.1 330 Ylr181cp [Saccharomyces cerevisiae]
GI:6323210 GenBank EIW08790.1 330 Vta1p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:6323210 SwissProt Q06263.1 330 RecName: Full=Vacuolar protein sorting-associated protein VTA1; AltName: Full=VPS20-associated protein 1 [Saccharomyces cerevisiae S288c]
GI:6323210 Third Party Genbank DAA09501.1 330 TPA: Vta1p [Saccharomyces cerevisiae S288c]

Related Sequences to LMP007538 proteins

Reference Database Accession Length Protein Name
GI:6323210 EMBL CAY81418.1 330 Vta1p [Saccharomyces cerevisiae EC1118]
GI:6323210 GenBank AAA66933.1 330 unknown protein [Saccharomyces cerevisiae]
GI:6323210 GenBank EDN59405.1 330 Vps20 associated protein [Saccharomyces cerevisiae YJM789]
GI:6323210 GenBank EEU09276.1 330 Vta1p [Saccharomyces cerevisiae JAY291]
GI:6323210 GenBank EGA57631.1 330 Vta1p [Saccharomyces cerevisiae FostersB]
GI:6323210 GenBank EWG94361.1 330 Vta1p [Saccharomyces cerevisiae R103]