Gene/Proteome Database (LMPD)
Proteins
| Iah1p | |
|---|---|
| Refseq ID | NP_014769 |
| Protein GI | 398365271 |
| UniProt ID | P41734 |
| mRNA ID | NM_001183545 |
| Length | 238 |
| MDYEKFLLFGDSITEFAFNTRPIEDGKDQYALGAALVNEYTRKMDILQRGFKGYTSRWALKILPEILKHESNIVMATIFLGANDACSAGPQSVPLPEFIDNIRQMVSLMKSYHIRPIIIGPGLVDREKWEKEKSEEIALGYFRTNENFAIYSDALAKLANEEKVPFVALNKAFQQEGGDAWQQLLTDGLHFSGKGYKIFHDELLKVIETFYPQYHPKNMQYKLKDWRDVLDDGSNIMS | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016788 | IDA:SGD | F | hydrolase activity, acting on ester bonds |
| GO:0006083 | IDA:SGD | P | acetate metabolic process |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=40.3 mM for isoamyl acetate {ECO:0000269|PubMed:10855721}; pH dependence: Optimum pH is 7.5. {ECO:0000269|PubMed:10855721}; |
| Biophysicochemical Properties | Kinetic parameters: KM=40.3 mM for isoamyl acetate ; pH dependence: Optimum pH is 7.5. ; |
| Function | Plays a crucial role in the hydrolysis of isoamyl acetate in sake mash. |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. IAH1 subfamily |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. IAH1 subfamily. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007520 (as displayed in Record Overview)
Identical Sequences to LMP007520 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007520 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|