Gene/Proteome Database (LMPD)

LMPD ID
LMP007480
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
protein SHH3
Gene Symbol
Synonyms
-
Chromosome
XIII

Proteins

protein SHH3
Refseq ID NP_013836
Protein GI 6323765
UniProt ID Q04487
mRNA ID NM_001182618
Length 196
MKATIQRVTSVFGVPRASVFVPRISTPFILHNYISNGRMDLFSKEFHNGRVSKSDLWSSNKEEELLVSQRKKRPISPHLTVYEPEMSWYLSSLHRISGVLLALGFYAFTITLGVTTIMGMDTTFQDLNKWYHEKMPKWSQWVAKGSAAYLFAFHFGNGIRHLIWDMGYELTNRGVIKTGSIVLAGTLVLGTYLLAQ

Gene Information

Entrez Gene ID
Gene Name
protein SHH3
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005743 IEA:UniProtKB-KW C mitochondrial inner membrane
GO:0045281 IEA:InterPro C succinate dehydrogenase complex
GO:0009055 IEA:InterPro F electron carrier activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0048038 IEA:UniProtKB-KW F quinone binding
GO:0000104 IEA:InterPro F succinate dehydrogenase activity
GO:0006099 IEA:UniProtKB-KW P tricarboxylic acid cycle

KEGG Pathway Links

KEGG Pathway ID Description
sce01110 Biosynthesis of secondary metabolites
ko01200 Carbon metabolism
sce01200 Carbon metabolism
ko00020 Citrate cycle (TCA cycle)
sce00020 Citrate cycle (TCA cycle)
M00009 Citrate cycle (TCA cycle, Krebs cycle)
sce_M00009 Citrate cycle (TCA cycle, Krebs cycle)
M00011 Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce_M00011 Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce01100 Metabolic pathways
ko00190 Oxidative phosphorylation
sce00190 Oxidative phosphorylation
M00148 Succinate dehydrogenase (ubiquinone)
sce_M00148 Succinate dehydrogenase (ubiquinone)

REACTOME Pathway Links

REACTOME Pathway ID Description
5618051 Citric acid cycle (TCA cycle)
5618023 Metabolism
5618052 Pyruvate metabolism and Citric Acid (TCA) cycle
5618290 Respiratory electron transport
5618291 Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
5618053 The citric acid (TCA) cycle and respiratory electron transport

Domain Information

InterPro Annotations

Accession Description
IPR000701 Succ_DH_Fumarate_Rdtase_TM-su
IPR018495 Succ_DH_cyt_bsu_CS
IPR014314 Succ_DH_cytb556

UniProt Annotations

Entry Information

Gene Name
protein SHH3
Protein Entry
SHH3_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Disruption Phenotype Does not affect SDH or TIM22 complex formation
Disruption Phenotype Does not affect SDH or TIM22 complex formation. {ECO:0000269|PubMed:22152483}.
Function Homolog of SDH3, but seems not to be a stoichiometric subunit of either the succinate dehydrogenase (SDH) complex or the mitochondrial inner membrane translocase TIM22 complex
Function Homolog of SDH3, but seems not to be a stoichiometric subunit of either the succinate dehydrogenase (SDH) complex or the mitochondrial inner membrane translocase TIM22 complex. {ECO:0000303|PubMed:22152483}.
Similarity Belongs to the cytochrome b560 family
Similarity Belongs to the cytochrome b560 family. {ECO:0000305}.
Subcellular Location Mitochondrion inner membrane ; Multi-pass membrane protein .
Subcellular Location Mitochondrion inner membrane {ECO:0000250|UniProtKB:P33421}; Multi-pass membrane protein {ECO:0000255}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007480 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6323765 RefSeq NP_013836 196 protein SHH3

Identical Sequences to LMP007480 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007480 proteins

Reference Database Accession Length Protein Name