Gene/Proteome Database (LMPD)
Proteins
| long-chain fatty acid transporter ACB1 | |
|---|---|
| Refseq ID | NP_011551 |
| Protein GI | 398365291 |
| UniProt ID | P31787 |
| mRNA ID | NM_001181166 |
| Length | 87 |
| RefSeq Status | PROVISIONAL |
| MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS | |
Gene Information
Entrez Gene ID
Gene Name
long-chain fatty acid transporter ACB1
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IDA:SGD | C | extracellular region |
| GO:0000062 | ISS:SGD | F | fatty-acyl-CoA binding |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0005324 | IMP:SGD | F | long-chain fatty acid transporter activity |
| GO:0001300 | IMP:SGD | P | chronological cell aging |
| GO:0015909 | IMP:SGD | P | long-chain fatty acid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
long-chain fatty acid transporter ACB1
Protein Entry
ACBP_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Function | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. |
| Miscellaneous | Present with 8500 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the ACBP family. {ECO:0000305}. |
| Similarity | Contains 1 ACB (acyl-CoA-binding) domain. {ECO:0000255|PROSITE-ProRule:PRU00573}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007478 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 398365291 | RefSeq | NP_011551 | 87 | long-chain fatty acid transporter ACB1 |
Identical Sequences to LMP007478 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:398365291 | GenBank | EIW10388.1 | 87 | Acb1p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:398365291 | GenBank | EWG85933.1 | 87 | Acb1p [Saccharomyces cerevisiae R008] |
| GI:398365291 | GenBank | EWG91022.1 | 87 | Acb1p [Saccharomyces cerevisiae P301] |
| GI:398365291 | GenBank | EWG95947.1 | 87 | Acb1p [Saccharomyces cerevisiae R103] |
| GI:398365291 | GenBank | EWH18298.1 | 87 | Acb1p [Saccharomyces cerevisiae P283] |
| GI:398365291 | gnl | McCuskerlabDuke | 87 | Acb1p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP007478 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:398365291 | EMBL | CAA69948.1 | 87 | ACB1 type 2 [Saccharomyces pastorianus] |
| GI:398365291 | EMBL | CAA69946.1 | 87 | ACB1 [Saccharomyces monacensis] |
| GI:398365291 | GenBank | AAB31936.1 | 86 | acyl-coA-binding protein type 1, ACBP type 1 [Saccharomyces bayanus] |
| GI:398365291 | GenBank | EJS43698.1 | 87 | acb1p [Saccharomyces arboricola H-6] |
| GI:398365291 | GenBank | EJT41453.1 | 87 | ACB1-like protein [Saccharomyces kudriavzevii IFO 1802] |
| GI:398365291 | PDB | 1ST7 | 86 | Chain A, Solution Structure Of Acyl Coenzyme A Binding Protein From Yeast |