Gene/Proteome Database (LMPD)

LMPD ID
LMP007469
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
calmodulin
Gene Symbol
Synonyms
-
Alternate Names
calmodulin
Chromosome
II

Proteins

calmodulin
Refseq ID NP_009667
Protein GI 6319585
UniProt ID P06787
mRNA ID NM_001178457
Length 147
RefSeq Status PROVISIONAL
MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSK

Gene Information

Entrez Gene ID
Gene Name
calmodulin
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005935 IDA:SGD C cellular bud neck
GO:0005934 IDA:SGD C cellular bud tip
GO:0005823 IDA:SGD C central plaque of spindle pole body
GO:0000131 IDA:SGD C incipient cellular bud site
GO:0043332 IDA:SGD C mating projection tip
GO:0005509 IDA:SGD F calcium ion binding
GO:0048306 IDA:SGD F calcium-dependent protein binding
GO:0006607 IMP:SGD P NLS-bearing protein import into nucleus
GO:0007114 IMP:SGD P cell budding
GO:0007010 IMP:SGD P cytoskeleton organization
GO:0000742 IMP:SGD P karyogamy involved in conjugation with cellular fusion
GO:0016237 IMP:SGD P microautophagy
GO:0006661 IMP:SGD P phosphatidylinositol biosynthetic process
GO:0006898 IMP:SGD P receptor-mediated endocytosis
GO:0051300 IMP:SGD P spindle pole body organization
GO:0042991 IMP:SGD P transcription factor import into nucleus
GO:0042144 IDA:SGD P vacuole fusion, non-autophagic

KEGG Pathway Links

KEGG Pathway ID Description
ko04070 Phosphatidylinositol signaling system
sce04070 Phosphatidylinositol signaling system

Domain Information

InterPro Annotations

Accession Description
IPR018247 EF-Hand 1, calcium-binding site
IPR002048 EF-hand domain
IPR011992 EF-hand domain pair

UniProt Annotations

Entry Information

Gene Name
calmodulin
Protein Entry
CALM_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Function Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Component of the spindle pole body (SPB) required for the proper execution of spindle pole body (SPB) duplication. {ECO:0000269|PubMed:10339566}.
Interaction P23287:CNA1; NbExp=3; IntAct=EBI-3976, EBI-12771; Q04439:MYO5; NbExp=7; IntAct=EBI-3976, EBI-11687; P32380:SPC110; NbExp=2; IntAct=EBI-3976, EBI-12369;
Miscellaneous This protein has three functional calcium-binding sites.
Ptm The N-terminus is blocked.
Similarity Belongs to the calmodulin family. {ECO:0000305}.
Similarity Contains 4 EF-hand domains. {ECO:0000255|PROSITE- ProRule:PRU00448}.
Subcellular Location Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body {ECO:0000269|PubMed:8247006}.
Subunit Component of the SPC110 complex containing at least CMD1, SPC29, SPC42 and SCP110. Interacts with SPC110. {ECO:0000269|PubMed:10339566, ECO:0000269|PubMed:8247006}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007469 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6319585 RefSeq NP_009667 147 calmodulin

Identical Sequences to LMP007469 proteins

Reference Database Accession Length Protein Name
GI:6319585 GenBank AGA48847.1 147 Sequence 42 from patent US 8324455
GI:6319585 GenBank EWG87689.1 147 Cmd1p [Saccharomyces cerevisiae R008]
GI:6319585 GenBank EWG92464.1 147 Cmd1p [Saccharomyces cerevisiae P301]
GI:6319585 GenBank EWG97546.1 147 Cmd1p [Saccharomyces cerevisiae R103]
GI:6319585 GenBank EWH19507.1 147 Cmd1p [Saccharomyces cerevisiae P283]
GI:6319585 gnl McCuskerlabDuke 147 Cmd1p [Saccharomyces cerevisiae YJM993]

Related Sequences to LMP007469 proteins

Reference Database Accession Length Protein Name
GI:6319585 DBBJ GAA21657.1 147 K7_Cmd1p [Saccharomyces cerevisiae Kyokai no. 7]
GI:6319585 EMBL CAG58389.1 147 unnamed protein product [Candida glabrata]
GI:6319585 GenBank EJT41753.1 147 CMD1-like protein [Saccharomyces kudriavzevii IFO 1802]
GI:6319585 PDB 1LKJ 146 Chain A, Nmr Structure Of Apo Calmodulin From Yeast Saccharomyces Cerevisiae
GI:6319585 PDB 2LHI 176 Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam
GI:6319585 RefSeq XP_445478.1 147 hypothetical protein [Candida glabrata CBS 138]