Gene/Proteome Database (LMPD)

LMPD ID
LMP007457
Gene ID
852978
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
indolepyruvate decarboxylase 6
Gene Symbol
PDC6
Synonyms
-
Chromosome
VII
EC Number
4.1.1.1;

Proteins

indolepyruvate decarboxylase 6
Refseq ID NP_011601
Protein GI 398365599
UniProt ID P26263
mRNA ID NM_001181216
Length 563
MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADGYARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSLLEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQFPAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYSYKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVPASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTGATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLIHGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKLPVFDAPESLIKQAQLTAATNAKQ

Gene Information

Entrez Gene ID
852978
Gene Name
indolepyruvate decarboxylase 6
Gene Symbol
PDC6
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0000287 IEA:InterPro F magnesium ion binding
GO:0004737 IDA:SGD F pyruvate decarboxylase activity
GO:0030976 IEA:InterPro F thiamine pyrophosphate binding
GO:0006559 IGI:SGD P L-phenylalanine catabolic process
GO:0000949 IGI:SGD P aromatic amino acid family catabolic process to alcohol via Ehrlich pathway
GO:0009083 IEA:UniProtKB-KW P branched-chain amino acid catabolic process
GO:0006067 IMP:SGD P ethanol metabolic process
GO:0006569 IGI:SGD P tryptophan catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
sce01110 Biosynthesis of secondary metabolites
ko00010 Glycolysis / Gluconeogenesis
sce00010 Glycolysis / Gluconeogenesis
sce01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6333 acetaldehyde biosynthesis
PWY3O-440 acetoin biosynthesis III
PWY3O-440 acetoin biosynthesis III
PWY-7396 butanol and isobutanol biosynthesis (engineered)
PWY3O-4109 isoleucine degradation
PWY-5078 isoleucine degradation II
PWY-5078 isoleucine degradation II
PWY-5079 phenylalanine degradation
ANAPHENOXI-PWY phenylalanine degradation II (anaerobic)
PWY-5079 phenylalanine degradation III
PWY-5768 pyruvate fermentation to acetate VIII
PWY-5486 pyruvate fermentation to ethanol II
PWY-5486 pyruvate fermentation to ethanol II
PWY-7111 pyruvate fermentation to isobutanol (engineered)
PWY3O-981 superpathway of acetoin and butanediol biosynthesis
PWY-5081 tryptophan degradation VIII (to tryptophol)
PWY-5081 tryptophan degradation VIII (to tryptophol)
PWY3O-4108 tyrosine degradation
PWY3O-4108 tyrosine degradation III
PWY-5057 valine degradation
PWY-5057 valine degradation II

Domain Information

InterPro Annotations

Accession Description
IPR029035 DHS-like NAD/FAD-binding domain
IPR000399 TPP-binding enzyme, conserved site
IPR029061 Thiamin diphosphate-binding fold
IPR012110 Thiamine pyrophosphate (TPP)-dependent enzyme
IPR011766 Thiamine pyrophosphate enzyme, C-terminal TPP-binding
IPR012001 Thiamine pyrophosphate enzyme, N-terminal TPP-binding domain
IPR012000 Thiamine pyrophosphate enzyme, central domain

UniProt Annotations

Entry Information

Gene Name
indolepyruvate decarboxylase 6
Protein Entry
PDC6_YEAST
UniProt ID
P26263
Species
Yeast (S288c)

Comments

Comment Type Description
Biotechnology Fusel oils and acyloins are important flavor and aroma compounds in yeast-fermented products contributing to the quality of beverages and food, e.g. fusel oils in whiskey, contrary to common believe, seem to alleviate hangover. In general they are desirable at low concentrations, whereas high concentrations may spoil the product. By adjusting growth conditions and substrate their production is sought to be influenced. Due to their broad substrate tolerance pyruvate decarboxylases are important biocatalysts for chemoenzymatic syntheses, both by fermentation and in vitro, e.g. in the production of ephedrine, vitamin E, or phenylethanol (rose flavor)
Biotechnology Fusel oils and acyloins are important flavor and aroma compounds in yeast-fermented products contributing to the quality of beverages and food, e.g. fusel oils in whiskey, contrary to common believe, seem to alleviate hangover. In general they are desirable at low concentrations, whereas high concentrations may spoil the product. By adjusting growth conditions and substrate their production is sought to be influenced. Due to their broad substrate tolerance pyruvate decarboxylases are important biocatalysts for chemoenzymatic syntheses, both by fermentation and in vitro, e.g. in the production of ephedrine, vitamin E, or phenylethanol (rose flavor). {ECO:0000269|PubMed:9655924}.
Catalytic Activity 3-(indol-3-yl)pyruvate = 2-(indol-3- yl)acetaldehyde + CO(2).
Catalytic Activity A 2-oxo acid + an aldehyde = A 2-hydroxy ketone + CO(2).
Catalytic Activity A 2-oxo acid = an aldehyde + CO(2).
Catalytic Activity An aldehyde + an aldehyde = A 2-hydroxy ketone.
Catalytic Activity Phenylpyruvate = phenylacetaldehyde + CO(2).
Catalytic Activity Pyruvate = Acetaldehyde + CO(2).
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; Note=Binds 1 Mg(2+) per subunit. ;
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Note=Binds 1 Mg(2+) per subunit. {ECO:0000250};
Cofactor Name=thiamine diphosphate; Xref=ChEBI:CHEBI:58937; Evidence={ECO:0000250}; Note=Binds 1 thiamine pyrophosphate per subunit. {ECO:0000250};
Cofactor Name=thiamine diphosphate; Xref=ChEBI:CHEBI:58937; Evidence= ; Note=Binds 1 thiamine pyrophosphate per subunit. ;
Function Minor of three pyruvate decarboxylases (PDC1, PDC5, PDC6) implicated in the nonoxidative conversion of pyruvate to acetaldehyde and carbon dioxide during alcoholic fermentation. Most of the produced acetaldehyde is subsequently reduced to ethanol, but some is required for cytosolic acetyl-CoA production for biosynthetic pathways. The enzyme is also one of five 2-oxo acid decarboxylases (PDC1, PDC5, PDC6, ARO10, and THI3) able to decarboxylate more complex 2-oxo acids (alpha-keto-acids) than pyruvate, which seem mainly involved in amino acid catabolism. Here the enzyme catalyzes the decarboxylation of amino acids, which, in a first step, have been transaminated to the corresponding 2-oxo acids. In a third step, the resulting aldehydes are reduced to alcohols, collectively referred to as fusel oils or alcohols. Its preferred substrates are the transaminated amino acids valine, isoleucine, phenylalanine, and tryptophan, whereas leucine is no substrate. In a side-reaction the carbanionic intermediate (or active aldehyde) generated by decarboxylation or by activation of an aldehyde can react with an aldehyde via condensation (or carboligation) yielding a 2-hydroxy ketone, collectively called acyloins. The expression level of this protein in the presence of fermentable carbon sources is so low that it can not compensate for the other two pyruvate decarboxylases to sustain fermentation. {ECO:0000269|PubMed:10234824, ECO:0000269|PubMed:10753893, ECO:0000269|PubMed:11141278, ECO:0000269|PubMed:12499363, ECO:0000269|PubMed:12902239, ECO:0000269|PubMed:9341119, ECO:0000269|PubMed:9748245}.
Induction Expression is very low in the presence of fermentable carbon sources, but is induced, in contrast to PDC5, by ethanol.
Miscellaneous Present with 1525 molecules/cell in log phase SD medium
Miscellaneous Present with 1525 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Amino-acid degradation; Ehrlich pathway.
Pathway Fermentation; ethanol fermentation.
Similarity Belongs to the TPP enzyme family
Similarity Belongs to the TPP enzyme family. {ECO:0000305}.
Subcellular Location Cytoplasm .
Subcellular Location Cytoplasm {ECO:0000269|PubMed:14562095}.
Subunit Homotetramer
Subunit Homotetramer. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007457 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398365599 RefSeq NP_011601 563 indolepyruvate decarboxylase 6

Identical Sequences to LMP007457 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007457 proteins

Reference Database Accession Length Protein Name