Gene/Proteome Database (LMPD)

LMPD ID
LMP007456
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
lipid-binding protein HSP12
Gene Symbol
Synonyms
GLP1; HOR5
Alternate Names
lipid-binding protein HSP12
Chromosome
VI

Proteins

lipid-binding protein HSP12
Refseq ID NP_116640
Protein GI 14318506
UniProt ID P22943
mRNA ID NM_001179952
Length 109
RefSeq Status PROVISIONAL
MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK

Gene Information

Entrez Gene ID
Gene Name
lipid-binding protein HSP12
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:SGD C cytosol
GO:0005768 IDA:SGD C endosome
GO:0005886 IDA:SGD C plasma membrane
GO:0008289 IDA:SGD F lipid binding
GO:0007155 IDA:SGD P cell adhesion
GO:0034605 IMP:SGD P cellular response to heat
GO:0071470 IMP:SGD P cellular response to osmotic stress
GO:0034599 IMP:SGD P cellular response to oxidative stress
GO:0007009 IMP:SGD P plasma membrane organization

Domain Information

InterPro Annotations

Accession Description
IPR007250 Heat shock protein 9/12
IPR016360 Heat shock protein, 9/12, fungi

UniProt Annotations

Entry Information

Gene Name
lipid-binding protein HSP12
Protein Entry
HSP12_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Function May play a role in a switch from carbohydrate utilizing metabolism to fatty acid utilizing metabolism.
Induction Strong, by heat shock, by entry in the stationary growth phase, and by cAMP, probably via the activity of a cAMP- dependent protein kinase. By glucose starvation and by fatty acids.
Miscellaneous Present with 4490 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity To S.pombe hsp9 and C.albicans WH11. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007456 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
14318506 RefSeq NP_116640 109 lipid-binding protein HSP12

Identical Sequences to LMP007456 proteins

Reference Database Accession Length Protein Name
GI:14318506 DBBJ GAA23069.1 109 K7_Hsp12p [Saccharomyces cerevisiae Kyokai no. 7]
GI:14318506 GenBank ABZ47934.1 109 Sequence 21872 from patent US 7314974
GI:14318506 GenBank EIW10750.1 109 Hsp12p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:14318506 PDB 2L9Q 109 Chain A, Structural Characterization Of Small Heat Shock Protein (Hsp12)
GI:14318506 PDB 2LJL 109 Chain A, Nmr Structure Of Hsp12 In The Presence Of Dpc
GI:14318506 Third Party Genbank DAA12425.1 109 TPA: lipid-binding protein HSP12 [Saccharomyces cerevisiae S288c]

Related Sequences to LMP007456 proteins

Reference Database Accession Length Protein Name
GI:14318506 GenBank AAL06077.1 109 12 kDa heat shock protein [Saccharomyces cerevisiae]
GI:14318506 GenBank EDN59135.1 109 heat shock protein 12 [Saccharomyces cerevisiae YJM789]
GI:14318506 GenBank EEU04229.1 109 Hsp12p [Saccharomyces cerevisiae JAY291]
GI:14318506 GenBank EHN07337.1 109 Hsp12p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:14318506 GenBank EWG96252.1 109 Hsp12p [Saccharomyces cerevisiae R103]
GI:14318506 PDB 4AXP 109 Chain A, Nmr Structure Of Hsp12, A Protein Induced By And Required For Dietary Restriction-Induced Lifespan Extension In Yeast.