Gene/Proteome Database (LMPD)
Proteins
| Tax4p | |
|---|---|
| Refseq ID | NP_012452 |
| Protein GI | 6322378 |
| UniProt ID | P47030 |
| mRNA ID | NM_001181516 |
| Length | 604 |
| MHFPKKKHSGNLSVVELPKEALQDSLTAAQITFKRYAHPNGNAGSAERPRHLKVESAPVVKSEPSLPRMRQPEPRSINHQYSRETLPGHSEAFSVPTTPLQTIHYDVRNKASNSPSSIAAAETAAYLAHTNSFSNRSSGVGSRDPVMDTETKPPRAPSALKNELQLNRMRIPPPSYDNNVRSRSISPQVSYSTSLSSSCSISSDGEETSYREKSTDEAFPPEPSMSSYSLASKASAKASLTDPSQRQQESDYTAMNKLNGGNIIYKGTLPDLIPRSQRKTSKPRFKHRLLRSPEQQQENLSRVYSDQTQNGRAIINTQQNVKLKTTMRRGKYAITDNDETFPYDRKSVSSDSDTDEDSNVMEIKDKKKKSRRSKIKKGLKTTAAVVGSSTSVLPFPHHHHHHHQLHNPNSHHLHTHHHTSSHKFNEDKPWKSHRDLGFITEQERKRYESMWVSNRYSYLRLLPWWPSLANEDDESHLQPLNLPQDGLMLNLVVKDIWYRSNLPRDLLVQIYNMVDTRKDGTLDRKSFIVGMWLVDQCLYGRKLTNELDQRVWNSVDGYVLGTINVKPATSDHYHNANNPLDKPSKLSVRQELKNIKRDLRNVRI | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000407 | IDA:SGD | C | pre-autophagosomal structure |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0006914 | IGI:SGD | P | autophagy |
| GO:0009267 | IGI:SGD | P | cellular response to starvation |
| GO:0031505 | IGI:SGD | P | fungal-type cell wall organization |
| GO:0048017 | IGI:SGD | P | inositol lipid-mediated signaling |
| GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | With IRS4, acts as a positive regulator of INP51 activity and phosphatidylinositol 4,5-bisphosphate turnover. Negatively regulates signaling through the cell integrity pathway, including the MAP kinase SLT2 |
| Function | With IRS4, acts as a positive regulator of INP51 activity and phosphatidylinositol 4,5-bisphosphate turnover. Negatively regulates signaling through the cell integrity pathway, including the MAP kinase SLT2. {ECO:0000269|PubMed:15265867}. |
| Interaction | P40559:INP51; NbExp=3; IntAct=EBI-25970, EBI-24915; |
| Miscellaneous | Present with 396 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 396 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the IRS4 family |
| Similarity | Belongs to the IRS4 family. {ECO:0000305}. |
| Similarity | Contains 1 EH domain |
| Similarity | Contains 1 EH domain. {ECO:0000305}. |
| Subunit | Interacts with INP51 |
| Subunit | Interacts with INP51. {ECO:0000269|PubMed:15265867}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007449 (as displayed in Record Overview)
Identical Sequences to LMP007449 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007449 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|