Gene/Proteome Database (LMPD)
Proteins
| Ldh1p | |
|---|---|
| Refseq ID | NP_009763 |
| Protein GI | 330443463 |
| UniProt ID | P38139 |
| mRNA ID | NM_001178552 |
| Length | 375 |
| MNMAERAEATKSWSCEPLSGKTLEEIVQNAENAADLVAYIRKPEVDLDFRLKFIAEHEEFFNVQLSDRNSRIRTCHNLSDKGIRGDTVFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLVCDVLRKWSTAVPNNDNVNPFNGHKIVLVGHSMGCFLACHLYEQHMADTKAVQTLVLLTPPKAHIEQLSKDKHIIQWALYGVFKLPWLFDVYRNKFDQVKGLQSSGIKQYFYQQGDDVKLKYRKFWQFKNNISNKSRTIIGYLLGWETVDWVKFNGVLTQTDMKQKIIIFGAEKDPIAPIENLEFYKQTINKECLRKVIILPDCSHNLCFDRPELVCENFQREVIDNSKL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005811 | IDA:SGD | C | lipid particle |
| GO:0016788 | IDA:SGD | F | hydrolase activity, acting on ester bonds |
| GO:0004806 | IDA:SGD | F | triglyceride lipase activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0055088 | IMP:SGD | P | lipid homeostasis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=0.77 uM for p-nitrophenyl butyrate (PNB) {ECO:0000269|PubMed:21478434}; KM=3.3 mM for 1,2-dioleoyl-3-(pyren-1-yl)-decanoyl-rac-glycerol (DPG) {ECO:0000269|PubMed:21478434}; Vmax=0.041 umol/min/mg enzyme for esterase activity using PNB as a substrate {ECO:0000269|PubMed:21478434}; Vmax=1 umol/min/mg enzyme for triacylglycerol lipase activity using DPG as a substrate {ECO:0000269|PubMed:21478434}; |
| Biophysicochemical Properties | Kinetic parameters: KM=0.77 uM for p-nitrophenyl butyrate (PNB) ; KM=3.3 mM for 1,2-dioleoyl-3-(pyren-1-yl)-decanoyl-rac-glycerol (DPG) ; Vmax=0.041 umol/min/mg enzyme for esterase activity using PNB as a substrate ; Vmax=1 umol/min/mg enzyme for triacylglycerol lipase activity using DPG as a substrate ; |
| Catalytic Activity | Triacylglycerol + H(2)O = diacylglycerol + a carboxylate. |
| Disruption Phenotype | Leads to the appearance of giant lipid droplets and an excessive accumulation of non-polar lipids and phospholipids upon growth on medium containing oleic acid as a sole carbon source |
| Disruption Phenotype | Leads to the appearance of giant lipid droplets and an excessive accumulation of non-polar lipids and phospholipids upon growth on medium containing oleic acid as a sole carbon source. {ECO:0000269|PubMed:21478434}. |
| Function | Serine hydrolase required for the maintenance of steady state level of non-polar and polar lipids of lipid droplets and thus plays a role in maintaining the lipids homeostasis. Exhibits both esterase and triacylglycerol lipase activity |
| Function | Serine hydrolase required for the maintenance of steady state level of non-polar and polar lipids of lipid droplets and thus plays a role in maintaining the lipids homeostasis. Exhibits both esterase and triacylglycerol lipase activity. {ECO:0000269|PubMed:21478434}. |
| Similarity | Belongs to the AB hydrolase superfamily. Lipase family |
| Similarity | Belongs to the AB hydrolase superfamily. Lipase family. {ECO:0000305}. |
| Subcellular Location | Lipid droplet . |
| Subcellular Location | Lipid droplet {ECO:0000269|PubMed:21478430}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007446 (as displayed in Record Overview)
Identical Sequences to LMP007446 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007446 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|