Gene/Proteome Database (LMPD)
Proteins
| Tfs1p | |
|---|---|
| Refseq ID | NP_013279 |
| Protein GI | 6323207 |
| UniProt ID | P14306 |
| mRNA ID | NM_001182065 |
| Length | 219 |
| MNQAIDFAQASIDSYKKHGILEDVIHDTSFQPSGILAVEYSSSAPVAMGNTLPTEKARSKPQFQFTFNKQMQKSVPQANAYVPQDDDLFTLVMTDPDAPSKTDHKWSEFCHLVECDLKLLNEATHETSGATEFFASEFNTKGSNTLIEYMGPAPPKGSGPHRYVFLLYKQPKGVDSSKFSKIKDRPNWGYGTPATGVGKWAKENNLQLVASNFFYAETK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:SGD | C | cytoplasm |
| GO:0000328 | IDA:SGD | C | fungal-type vacuole lumen |
| GO:0000329 | IDA:SGD | C | fungal-type vacuole membrane |
| GO:0008289 | ISS:SGD | F | lipid binding |
| GO:0030414 | IDA:SGD | F | peptidase inhibitor activity |
| GO:0005543 | IDA:SGD | F | phospholipid binding |
| GO:0004867 | IEA:UniProtKB-KW | F | serine-type endopeptidase inhibitor activity |
| GO:0046578 | IMP:SGD | P | regulation of Ras protein signal transduction |
| GO:0030162 | IDA:SGD | P | regulation of proteolysis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Specific and potent inhibitor of carboxypeptidase Y |
| Function | Specific and potent inhibitor of carboxypeptidase Y. {ECO:0000269|PubMed:9521655}. |
| Miscellaneous | Present with 1030 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 1030 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the phosphatidylethanolamine-binding protein family |
| Similarity | Belongs to the phosphatidylethanolamine-binding protein family. {ECO:0000305}. |
| Subcellular Location | Cytoplasm. |
| Subunit | Monomer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007431 (as displayed in Record Overview)
Identical Sequences to LMP007431 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007431 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|