Gene/Proteome Database (LMPD)

LMPD ID
LMP007320
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
sphingosine N-acyltransferase subunit LIP1
Gene Symbol
Synonyms
-
Chromosome
XIII

Proteins

sphingosine N-acyltransferase subunit LIP1
Refseq ID NP_014027
Protein GI 6323956
UniProt ID Q03579
mRNA ID NM_001182807
Length 150
MSQPTPIITTKSAAKPKPKIFNLFRVCFISLLLIAAVEYFKYGTRINYEWFHCTPIKEPQSGSVIKLWARGGPSCDKRGEYKTIVKRITRDYEPNDEHLSFCIIENDNVPPVHYPIHEDKGEPGYVAYVGYDTDSELVQELCADSTIYHM

Gene Information

Entrez Gene ID
Gene Name
sphingosine N-acyltransferase subunit LIP1
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0061576 IDA:SGD C acyl-CoA ceramide synthase complex
GO:0005789 IDA:SGD C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0046513 IMP:SGD P ceramide biosynthetic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
SPHINGOLIPID-SYN-PWY sphingolipid biosynthesis
SPHINGOLIPID-SYN-PWY sphingolipid biosynthesis (yeast)

Domain Information

InterPro Annotations

Accession Description

UniProt Annotations

Entry Information

Gene Name
sphingosine N-acyltransferase subunit LIP1
Protein Entry
LIP1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Function Component of the ceramide synthase complex required for synthesis of ceramides
Function Component of the ceramide synthase complex required for synthesis of ceramides. {ECO:0000269|PubMed:15692566}.
Interaction P28496:LAC1; NbExp=6; IntAct=EBI-27640, EBI-26585; P38703:LAG1; NbExp=4; IntAct=EBI-27640, EBI-10035;
Similarity Belongs to the LIP1 family
Similarity Belongs to the LIP1 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane ; Single-pass type II membrane protein .
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:15692566}; Single-pass type II membrane protein {ECO:0000269|PubMed:15692566}.
Subunit Component of the ceramide synthase complex composed of at least LAC1, LAG1 and LIP1.

Identical and Related Proteins

Unique RefSeq proteins for LMP007320 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6323956 RefSeq NP_014027 150 sphingosine N-acyltransferase subunit LIP1

Identical Sequences to LMP007320 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007320 proteins

Reference Database Accession Length Protein Name