Gene/Proteome Database (LMPD)

LMPD ID
LMP007267
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
Vac14p
Gene Symbol
Synonyms
-
Chromosome
XII

Proteins

Vac14p
Refseq ID NP_013490
Protein GI 398366065
UniProt ID Q06708
mRNA ID NM_001182275
Length 880
MEKSIAKGLSDKLYEKRKAAALELEKLVKQCVLEGDYDRIDKIIDELCRDYAYALHQPMARNAGLMGLAATAIALGINDVGRYLRNILPPVLACFGDQNDQVRFYACESLYNIAKIAKGEILVYFNEIFDVLCKISADTENSVRGAAELLDRLIKDIVAERASNYISIVNNGSHGLLPAIKTDPISGDVYQEEYEQDNQLAFSLPKFIPLLTERIYAINPDTRVFLVDWLKVLLNTPGLELISYLPSFLGGLFTFLGDSHKDVRTVTHTLMDSLLHEVDRISKLQTEIKMKRLERLKMLEDKYNNSSTPTKKADGALIAEKKKTLMTALGGLSKPLSMETDDTKLSNTNETDDERHLTSQEQLLDSEATSQEPLRDGEEYIPGQDINLNFPEVITVLVNNLASSEAEIQLIALHWIQVILSISPNVFIPFLSKILSVLLKLLSDSDPHITEIAQLVNGQLLSLCSSYVGKETDGKIAYGPIVNSLTLQFFDSRIDAKIACLDWLILIYHKAPNQILKHNDSMFLTLLKSLSNRDSVLIEKALSLLQSLCSDSNDNYLRQFLQDLLTLFKRDTKLVKTRANFIMRQISSRLSPERVYKVISSILDNYNDTTFVKMMIQILSTNLITSPEMSSLRNKLRTCEDGMFFNSLFKSWCPNPVSVISLCFVAENYELAYTVLQTYANYELKLNDLVQLDILIQLFESPVFTRMRLQLLEQQKHPFLHKCLFGILMIIPQSKAFETLNRRLNSLNIWTSQSYVMNNYIRQRENSNFCDSNSDISQRSVSQSKLHFQELINHFKAVSEEDEYSSDMIRLDHGANNKSLLLGSFLDGIDEDKQEIVTPISPMNEAINEEMESPNDNSSVILKDSGSLPFNRNVSDKLKK

Gene Information

Entrez Gene ID
Gene Name
Vac14p
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070772 IDA:SGD C PAS complex
GO:0000306 IDA:SGD C extrinsic component of vacuolar membrane
GO:0000329 IDA:SGD C fungal-type vacuole membrane
GO:0042802 IPI:IntAct F identical protein binding
GO:0030674 IDA:SGD F protein binding, bridging
GO:0006661 IMP:SGD P phosphatidylinositol biosynthetic process
GO:0033674 IMP:SGD P positive regulation of kinase activity
GO:0015031 IEA:UniProtKB-KW P protein transport
GO:0043550 IEA:InterPro P regulation of lipid kinase activity

REACTOME Pathway Links

REACTOME Pathway ID Description
5618023 Metabolism
5618091 Metabolism of lipids and lipoproteins
5618611 PI Metabolism
5618126 Phospholipid metabolism
5618614 Synthesis of PIPs at the Golgi membrane
5618615 Synthesis of PIPs at the early endosome membrane
5618612 Synthesis of PIPs at the late endosome membrane

Domain Information

InterPro Annotations

Accession Description
IPR011989 Armadillo-like helical
IPR016024 Armadillo-type fold
IPR000357 HEAT
IPR021133 HEAT, type 2
IPR021841 Vacuolar protein 14 C-terminal Fig4-binding domain
IPR026825 Vacuole morphology and inheritance protein 14

UniProt Annotations

Entry Information

Gene Name
Vac14p
Protein Entry
VAC14_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Domain The N-terminal domain mediates interaction with FAB1 and VAC7 while the C-terminal domain mediates interaction with FIG4
Domain The N-terminal domain mediates interaction with FAB1 and VAC7 while the C-terminal domain mediates interaction with FIG4. {ECO:0000269|PubMed:19037259}.
Function The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Regulates the synthesis of PtdIns(3,5)P2 by positive activation of FAB1 and by controlling FIG4 localization. Required for FIG4-mediated turnover of PtdIns(3,5)P2 after hyperosmotic shock. Essential for the control of trafficking of some proteins to the vacuole lumen via the multivesicular body (MVB), and for maintenance of vacuole size and acidity. {ECO:0000269|PubMed:11889142, ECO:0000269|PubMed:12062051, ECO:0000269|PubMed:14528018, ECO:0000269|PubMed:16492811, ECO:0000269|PubMed:19037259}.
Interaction Self; NbExp=4; IntAct=EBI-27189, EBI-27189; P43601:ATG18; NbExp=5; IntAct=EBI-27189, EBI-22968; P34756:FAB1; NbExp=9; IntAct=EBI-27189, EBI-6754; P42837:FIG4; NbExp=7; IntAct=EBI-27189, EBI-28407; P53950:VAC7; NbExp=4; IntAct=EBI-27189, EBI-28714;
Miscellaneous Present with 12388 molecules/cell in log phase SD medium
Miscellaneous Present with 12388 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the VAC14 family
Similarity Belongs to the VAC14 family. {ECO:0000305}.
Similarity Contains 5 HEAT repeats. {ECO:0000255|PROSITE- ProRule:PRU00103}.
Subcellular Location Vacuole membrane {ECO:0000269|PubMed:11889142, ECO:0000269|PubMed:14528018, ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:18653468, ECO:0000269|PubMed:19037259}; Peripheral membrane protein {ECO:0000269|PubMed:11889142, ECO:0000269|PubMed:14528018, ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:18653468, ECO:0000269|PubMed:19037259}. Note=Limiting membrane of the vacuole. Localization requires FAB1 and FIG4.
Subunit Component of the PI(3,5)P2 regulatory complex, composed of ATG18, FIG4, FAB1, VAC14 and VAC7. VAC14 nucleates the assembly of the complex and serves as a scaffold
Subunit Component of the PI(3,5)P2 regulatory complex, composed of ATG18, FIG4, FAB1, VAC14 and VAC7. VAC14 nucleates the assembly of the complex and serves as a scaffold. {ECO:0000269|PubMed:18653468, ECO:0000269|PubMed:19037259}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007267 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398366065 RefSeq NP_013490 880 Vac14p

Identical Sequences to LMP007267 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007267 proteins

Reference Database Accession Length Protein Name