Gene/Proteome Database (LMPD)
Proteins
| Yah1p | |
|---|---|
| Refseq ID | NP_015071 |
| Protein GI | 6325004 |
| UniProt ID | Q12184 |
| mRNA ID | NM_001184066 |
| Length | 172 |
| MLKIVTRAGHTARISNIAAHLLRTSPSLLTRTTTTTRFLPFSTSSFLNHGHLKKPKPGEELKITFILKDGSQKTYEVCEGETILDIAQGHNLDMEGACGGSCACSTCHVIVDPDYYDALPEPEDDENDMLDLAYGLTETSRLGCQIKMSKDIDGIRVALPQMTRNVNNNDFS | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005759 | IDA:UniProtKB | C | mitochondrial matrix |
| GO:0051537 | IEA:InterPro | F | 2 iron, 2 sulfur cluster binding |
| GO:0009055 | NAS:UniProtKB | F | electron carrier activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0006784 | IMP:SGD | P | heme a biosynthetic process |
| GO:0016226 | IDA:UniProtKB | P | iron-sulfur cluster assembly |
| GO:0055114 | IEA:UniProtKB-KW | P | oxidation-reduction process |
| GO:0006744 | IMP:SGD | P | ubiquinone biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-7235 | superpathway of ubiquinol-6 biosynthesis |
| PWY-7230 | ubiquinol-6 biosynthesis from 4-aminobenzoate |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=[2Fe-2S] cluster; Xref=ChEBI:CHEBI:49601; Evidence={ECO:0000250}; Note=Binds 1 [2Fe-2S] cluster. {ECO:0000250}; |
| Cofactor | Name=[2Fe-2S] cluster; Xref=ChEBI:CHEBI:49601; Evidence= ; Note=Binds 1 [2Fe-2S] cluster. ; |
| Function | Required for Fe-S cluster incorporation into mitochondrial and cytosolic apoproteins. May be part of a novel electron transport chain |
| Function | Required for Fe-S cluster incorporation into mitochondrial and cytosolic apoproteins. May be part of a novel electron transport chain. {ECO:0000269|PubMed:10655482}. |
| Miscellaneous | Present with 14800 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 14800 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the adrenodoxin/putidaredoxin family |
| Similarity | Belongs to the adrenodoxin/putidaredoxin family. {ECO:0000305}. |
| Similarity | Contains 1 2Fe-2S ferredoxin-type domain |
| Similarity | Contains 1 2Fe-2S ferredoxin-type domain. {ECO:0000255|PROSITE-ProRule:PRU00465}. |
| Subcellular Location | Mitochondrion matrix . |
| Subcellular Location | Mitochondrion matrix {ECO:0000269|PubMed:10375636, ECO:0000269|PubMed:10655482}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007252 (as displayed in Record Overview)
Identical Sequences to LMP007252 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007252 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|