Gene/Proteome Database (LMPD)
Proteins
| Yju3p | |
|---|---|
| Refseq ID | NP_012829 |
| Protein GI | 6322756 |
| UniProt ID | P28321 |
| mRNA ID | NM_001179660 |
| Length | 313 |
| RefSeq Status | PROVISIONAL |
| MAPYPYKVQTTVPELQYENFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFGEYTKIQFRLMDHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLEHFVEKNLSECKAKGIPLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGPLIILHPHTMYNKPTQIIAPLLAKFLPRVRIDTGLDLKGITSDKAYRAFLGSDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAKDKPVIIMHGQDDTINDPKGSEKFIQDCPSADKELKLYPGARHSIFSLETDKVFNTVFNDMKQWLDKHTTTEAKP | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0005811 | IDA:SGD | C | lipid particle |
| GO:0016020 | IDA:SGD | C | membrane |
| GO:0005741 | IEA:UniProtKB-KW | C | mitochondrial outer membrane |
| GO:0047372 | IMP:SGD | F | acylglycerol lipase activity |
| GO:0019433 | IEA:UniProtKB-UniPathway | P | triglyceride catabolic process |
| GO:0006641 | IMP:SGD | P | triglyceride metabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-7420 | monoacylglycerol metabolism |
| LIPAS-PWY | triacylglycerol degradation |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=260 uM for rac-1(3)-oleoylglycerol {ECO:0000269|PubMed:20554061}; Vmax=10.3 mmol/h/mg enzyme {ECO:0000269|PubMed:20554061}; pH dependence: Active from pH 4.5 to 8. {ECO:0000269|PubMed:20554061}; |
| Catalytic Activity | Hydrolyzes glycerol monoesters of long-chain fatty acids. |
| Function | Converts monoacylglycerides (MAG) to free fatty acids and glycerol. Required for efficient degradation of MAG, short- lived intermediates of glycerolipid metabolism which may also function as lipid signaling molecules. Controls inactivation of the signaling lipid N-palmitoylethanolamine (PEA). {ECO:0000269|PubMed:19529773, ECO:0000269|PubMed:20554061}. |
| Miscellaneous | Present with 2140 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Glycerolipid metabolism; triacylglycerol degradation. |
| Similarity | Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family. {ECO:0000305}. |
| Subcellular Location | Cytoplasm. Endoplasmic reticulum. Lipid droplet. Mitochondrion outer membrane. Note=Although the protein was identified in the cytoplasm, several membrane systems and lipid droplets, MGL activity was only measured in membrane fractions and lipid droplets. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007248 (as displayed in Record Overview)
Identical Sequences to LMP007248 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6322756 | DBBJ | GAA24632.1 | 313 | K7_Yju3p [Saccharomyces cerevisiae Kyokai no. 7] |
| GI:6322756 | EMBL | CBK51692.1 | 313 | unnamed protein product [Saccharomyces cerevisiae] |
| GI:6322756 | GenBank | ABZ48307.1 | 313 | Sequence 22245 from patent US 7314974 |
| GI:6322756 | GenBank | EIW09138.1 | 313 | Yju3p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6322756 | SwissProt | P28321.2 | 313 | RecName: Full=Monoglyceride lipase; Short=MGL; AltName: Full=Monoacylglycerol hydrolase; Short=MAG hydrolase; Short=MGH; AltName: Full=Monoacylglycerol lipase; Short=MAG lipase; Short=MAGL; AltName: Full=Serine hydrolase YJU3 [Saccharomyces cerevisiae S288c] |
| GI:6322756 | Third Party Genbank | DAA09064.1 | 313 | TPA: Yju3p [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007248 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6322756 | EMBL | CBD18346.1 | 313 | unnamed protein product [Saccharomyces cerevisiae] |
| GI:6322756 | EMBL | CBC65080.1 | 313 | unnamed protein product [Saccharomyces cerevisiae] |
| GI:6322756 | GenBank | EGA61615.1 | 313 | Yju3p [Saccharomyces cerevisiae FostersO] |
| GI:6322756 | GenBank | EWG90065.1 | 313 | Yju3p [Saccharomyces cerevisiae P301] |
| GI:6322756 | GenBank | EWG94912.1 | 313 | Yju3p [Saccharomyces cerevisiae R103] |
| GI:6322756 | GenBank | EWH17550.1 | 313 | Yju3p [Saccharomyces cerevisiae P283] |