Gene/Proteome Database (LMPD)
Proteins
| Slm2p | |
|---|---|
| Refseq ID | NP_014351 |
| Protein GI | 398365255 |
| UniProt ID | P53955 |
| mRNA ID | NM_001182886 |
| Length | 656 |
| RefSeq Status | PROVISIONAL |
| MSYQRNSARASLDLRSQYQQLEGRMRSEHFNPAYQQQQQKGQNIPLSLPSSLAQRNPIPYPIDAVTSDPTIPAQLNVYDHDRQNSIVDAAAGTNTTHSLNSNNIPSSQNNNINNNNINNVGSFTDPSMLTLPKMSLHSHQKQYDSNQNDPRSPLAILIPTSAQPTDVLSARFSAWRNVIRAILVYLSETASIQDEIVRQQLRLSHAVQFPFFSIENQYQPVSNEDKSMQKFFLPLGSGSVQDLPTMLTKYHDNLASLASKSSKELTSEIIPRLEDLRRDLLVKIKEIKALQSDFKNSCNKELQQTKHLMKLFNESLKECKLGTPKSDPFLIKLQLEKQIKRQLVEENYLHEAFDNLQNSGAQLESVIVMEIQNGLTSYARILGKEAQVVFDSVISKLDSTILNKNTNLEWDSFILRNISNFVPPNLPMRRFKEISYSNQNDPFTFEVKSGFLEKRSKFLKSYSRGFYVLTPSFLHEFKTPDKHKFSTPLMSIPLVECTVTEHSKKTKSNSEQGKNKFILRTNSNGLIHRGHNWVFKVDSYDDMIEWFGNIKALSSLPNYDDKCKYVSKVAKLSKEKAKSNENTTESVTPQVTNEQHTRYDDVSSSNFPLNSIPKLDNLTITNTTSSIPETNDSQIQNRVPEFYIENVDSPRKSNQL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031932 | IPI:SGD | C | TORC2 complex |
| GO:0005886 | IDA:SGD | C | plasma membrane |
| GO:0035091 | TAS:SGD | F | phosphatidylinositol binding |
| GO:0031929 | IPI:SGD | P | TOR signaling |
| GO:0030036 | IGI:SGD | P | actin cytoskeleton organization |
| GO:0051017 | IGI:SGD | P | actin filament bundle assembly |
| GO:0070941 | IGI:SGD | P | eisosome assembly |
| GO:0016197 | IGI:SGD | P | endosomal transport |
| GO:0030950 | IPI:SGD | P | establishment or maintenance of actin cytoskeleton polarity |
| GO:0001558 | IGI:SGD | P | regulation of cell growth |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Together with SLM1, effector of the TORC2- and calcineurin-signaling pathways. Phosphorylated and activated by TORC2 under favorable growth conditions. Mediates actin polarization via inhibition of calcineurin-dependent transcription. Upon nutrient limitation or environmental stress, gets dephosphorylated by calcineurin, inhibiting interaction with TORC2, thereby antagonizing TORC2 signaling and mediating calcineurin-dependent actin depolarization. Also functions in heat-induced, calcineurin-mediated uracil permease (FUR4) endocytosis. {ECO:0000269|PubMed:15372071, ECO:0000269|PubMed:15689497, ECO:0000269|PubMed:16738335}. |
| Interaction | P43603:LSB3; NbExp=2; IntAct=EBI-28706, EBI-22980; |
| Miscellaneous | Present with 2610 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Contains 1 PH domain. {ECO:0000255|PROSITE- ProRule:PRU00145}. |
| Subcellular Location | Cell membrane {ECO:0000269|PubMed:15023338, ECO:0000269|PubMed:15372071, ECO:0000269|PubMed:15689497}; Peripheral membrane protein {ECO:0000269|PubMed:15023338, ECO:0000269|PubMed:15372071, ECO:0000269|PubMed:15689497}; Cytoplasmic side {ECO:0000269|PubMed:15023338, ECO:0000269|PubMed:15372071, ECO:0000269|PubMed:15689497}. |
| Subunit | Heterodimer of SLM1-SLM2. Binds phosphatidylinositol 4,5- bisphosphate, which is required for function. Interacts with the TORC2 subunits AVO2, BIT61 and TOR2. Interacts with the calcineurin catalytic subunits CNA1 and CNA2. {ECO:0000269|PubMed:15372071, ECO:0000269|PubMed:15689497, ECO:0000269|PubMed:16738335}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007244 (as displayed in Record Overview)
Identical Sequences to LMP007244 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:398365255 | EMBL | CAA95915.1 | 656 | unnamed protein product [Saccharomyces cerevisiae] |
| GI:398365255 | GenBank | AAT92677.1 | 656 | YNL047C [Saccharomyces cerevisiae] |
| GI:398365255 | GenBank | AAV20394.1 | 656 | Sequence 654 from patent US 6753314 |
| GI:398365255 | GenBank | EIW08045.1 | 656 | Slm2p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:398365255 | SwissProt | P53955.1 | 656 | RecName: Full=Phosphatidylinositol 4,5-bisphosphate-binding protein SLM2; AltName: Full=Synthetic lethal with MSS4 protein 2; AltName: Full=TORC2 effector protein SLM2 [Saccharomyces cerevisiae S288c] |
| GI:398365255 | Third Party Genbank | DAA10498.1 | 656 | TPA: Slm2p [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007244 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:398365255 | DBBJ | GAA26048.1 | 656 | K7_Slm2p [Saccharomyces cerevisiae Kyokai no. 7] |
| GI:398365255 | EMBL | CAY82554.1 | 656 | Slm2p [Saccharomyces cerevisiae EC1118] |
| GI:398365255 | GenBank | EWG83791.1 | 656 | Slm2p [Saccharomyces cerevisiae R008] |
| GI:398365255 | GenBank | EWG89179.1 | 656 | Slm2p [Saccharomyces cerevisiae P301] |
| GI:398365255 | GenBank | EWG93840.1 | 656 | Slm2p [Saccharomyces cerevisiae R103] |
| GI:398365255 | gnl | McCuskerlabDuke | 656 | Slm2p [Saccharomyces cerevisiae YJM993] |