Gene/Proteome Database (LMPD)
Proteins
| Atg21p | |
|---|---|
| Refseq ID | NP_015225 |
| Protein GI | 6325157 |
| UniProt ID | Q02887 |
| mRNA ID | NM_001183914 |
| Length | 496 |
| RefSeq Status | PROVISIONAL |
| MKVLQFNQDATCCVVAASSHQISIFNCDPFGKCFEIDTKNSKKKTSNNNGSASNSESRNNEESILITNGSRDRTDAEEEEDNEDNALVTGNILKEGEFVIEMLFSTSLIAIADRGQGLNKGKKLKIVNTKRKCTICEIVFPHEIVDVVMNRKRMCVLLESDQIFIYDISCMKPLETIDLWEDHYKRSQANSFSNASNTGTLEGDSANLNRVATNLLANATQKSVNGSNPSVRTRRNSLRSKIRPRMVLSNDDRSILCFTAYSSPKKNKPNSEALYDVVIYDTLNVTPVNYLNSVHKGNVACLAVSHDGKLLATASDKGTIIRVFHTGVDSDYMSSRSLFKEFRRGTRLCNLYQLAFDKSMTMIGCVGDTDTIHLFKLDDASNSLPGDNSSNGHWNEEEYILASNSNPSMGTPKEIPLSKPRIANYFSKKIKSSIPNQNLSRNFAYITVNESNRSCLGFPDEFPNQVYIASDDGTFSIYSIPSKPGECVLTKNNKFT | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IDA:SGD | C | cytosol |
| GO:0005768 | IDA:SGD | C | endosome |
| GO:0000329 | IDA:SGD | C | fungal-type vacuole membrane |
| GO:0080025 | IDA:SGD | F | phosphatidylinositol-3,5-bisphosphate binding |
| GO:0032258 | IMP:SGD | P | CVT pathway |
| GO:0016236 | IMP:SGD | P | macroautophagy |
| GO:0000422 | IMP:SGD | P | mitochondrion degradation |
| GO:0034727 | IMP:SGD | P | piecemeal microautophagy of nucleus |
| GO:0006497 | IMP:SGD | P | protein lipidation |
| GO:0034497 | IMP:SGD | P | protein localization to pre-autophagosomal structure |
| GO:0016050 | IMP:SGD | P | vesicle organization |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Domain | Contains a beta-propeller domain involved in specific binding to phosphatidylinositol 3,5-bisphosphate (PIP2). |
| Domain | The FRRGT-motif is essential for the cytoplasm to vacuole transport (Cvt) pathway and for the recruitment of ATG8 and ATG16 to the PAS in nutrient-rich medium and in both its recruitment to and dissociation from the PAS under starvation conditions. |
| Function | Required for cytoplasm to vacuole transport (Cvt) vesicles formation and mitophagy. Involved in binding of phosphatidylethanolamine to ATG8 and in recruitment of ATG8 and ATG5 to the pre-autophagosomal structure. Protects ATG8 from ARG4- mediated cleavage. Essential for maturation of proaminopeptidase I. {ECO:0000269|PubMed:11536337, ECO:0000269|PubMed:11852075, ECO:0000269|PubMed:15155809, ECO:0000269|PubMed:15194695, ECO:0000269|PubMed:16876790, ECO:0000269|PubMed:18769150, ECO:0000269|PubMed:19793921, ECO:0000269|PubMed:20154084, ECO:0000269|PubMed:22108003}. |
| Miscellaneous | Present with 6020 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the WD repeat SVP1 family. {ECO:0000305}. |
| Similarity | Contains 3 WD repeats. {ECO:0000305}. |
| Subcellular Location | Cytoplasm. Vacuole. Note=And perivacuolar punctate structures. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007243 (as displayed in Record Overview)
Identical Sequences to LMP007243 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6325157 | GenBank | AAB68199.1 | 496 | Ypl100wp [Saccharomyces cerevisiae] |
| GI:6325157 | GenBank | EIW07012.1 | 496 | Atg21p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6325157 | SwissProt | Q02887.1 | 496 | RecName: Full=Autophagy-related protein 21; AltName: Full=Cytoplasm to vacuole transport protein 21; AltName: Full=Homologous with SVP1 protein 1; AltName: Full=Maturation of proaminopeptidase I protein 1 [Saccharomyces cerevisiae S288c] |
| GI:6325157 | Third Party Genbank | DAA11332.1 | 496 | TPA: Atg21p [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007243 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6325157 | GenBank | EDV11120.1 | 496 | hypothetical protein SCRG_02394 [Saccharomyces cerevisiae RM11-1a] |
| GI:6325157 | GenBank | EGA80480.1 | 496 | Atg21p [Saccharomyces cerevisiae Lalvin QA23] |
| GI:6325157 | GenBank | EGA84553.1 | 496 | Atg21p [Saccharomyces cerevisiae VL3] |
| GI:6325157 | GenBank | EWG85595.1 | 496 | Atg21p [Saccharomyces cerevisiae R008] |
| GI:6325157 | GenBank | EWG88444.1 | 496 | Atg21p [Saccharomyces cerevisiae P301] |
| GI:6325157 | GenBank | EWG92728.1 | 496 | Atg21p [Saccharomyces cerevisiae R103] |