Gene/Proteome Database (LMPD)

LMPD ID
LMP007232
Gene ID
851339
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
phosphoprotein phosphatase 2A catalytic subunit PPH22
Gene Symbol
PPH22
Synonyms
PPH2
Alternate Names
phosphoprotein phosphatase 2A catalytic subunit PPH22
Chromosome
IV
EC Number
3.1.3.16

Proteins

phosphoprotein phosphatase 2A catalytic subunit PPH22
Refseq ID NP_010093
Protein GI 6320013
UniProt ID P23595
mRNA ID NM_001180248
Length 377
RefSeq Status PROVISIONAL
MDMEIDDPMHGSDEDQLSPTLDEDMNSDDGKNNTKARSNDEDTDEELEDFNFKPGSSGIADHKSSKPLKLTNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPVTALVDNKIFCLHGGLSPMIETIDQVRDLNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVRPGEPTVTRKTPDYFL

Gene Information

Entrez Gene ID
851339
Gene Name
phosphoprotein phosphatase 2A catalytic subunit PPH22
Gene Symbol
PPH22
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000780 IDA:SGD C condensed nuclear chromosome, centromeric region
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0004722 IDA:SGD F protein serine/threonine phosphatase activity
GO:0000082 IGI:SGD P G1/S transition of mitotic cell cycle
GO:0007015 TAS:SGD P actin filament organization
GO:0007117 TAS:SGD P budding cell bud growth
GO:0007094 IPI:SGD P mitotic spindle assembly checkpoint
GO:0006470 IDA:SGD P protein dephosphorylation
GO:0006417 IPI:SGD P regulation of translation

KEGG Pathway Links

KEGG Pathway ID Description
sce04111 Cell cycle - yeast
sce04113 Meiosis - yeast
sce03015 mRNA surveillance pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5618419 ERKs are inactivated

Domain Information

InterPro Annotations

Accession Description
IPR004843 Calcineurin-like phosphoesterase domain, apaH type
IPR029052 Metallo-dependent phosphatase-like
IPR006186 Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase

UniProt Annotations

Entry Information

Gene Name
phosphoprotein phosphatase 2A catalytic subunit PPH22
Protein Entry
PP2A2_YEAST
UniProt ID
P23595
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; Note=Binds 2 manganese ions per subunit. {ECO:0000250};
Function Exact function not known, phosphatase 2A performs an essential cellular function.
Interaction P38074:HMT1; NbExp=3; IntAct=EBI-12752, EBI-8394; Q04372:TAP42; NbExp=4; IntAct=EBI-12752, EBI-18926; Q12199:TIP41; NbExp=3; IntAct=EBI-12752, EBI-38123;
Miscellaneous Present with 4110 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Ptm Reversibly methyl esterified on Leu-377 by leucine carboxyl methyltransferase 1 (PPM1) and protein phosphatase methylesterase 1 (PPE1). Carboxyl methylation influences the affinity of the catalytic subunit for the different regulatory subunits, thereby modulating the PP2A holoenzyme's substrate specificity, enzyme activity and cellular localization. {ECO:0000269|PubMed:11060018, ECO:0000269|PubMed:11697862}.
Similarity Belongs to the PPP phosphatase family. PP-2A subfamily. {ECO:0000305}.
Subunit Inactivated in a complex with phosphatase methylesterase PPE1 (PP2Ai). Interacts with phosphatase 2A activator RRD2, which can reactivate PP2Ai by dissociating the catalytic subunit from the complex. Interacts with TAP42. {ECO:0000269|PubMed:14551259, ECO:0000269|PubMed:15447631}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007232 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6320013 RefSeq NP_010093 377 phosphoprotein phosphatase 2A catalytic subunit PPH22

Identical Sequences to LMP007232 proteins

Reference Database Accession Length Protein Name
GI:6320013 DBBJ GAA22064.1 377 K7_Pph22p [Saccharomyces cerevisiae Kyokai no. 7]
GI:6320013 GenBank EHN03363.1 377 Pph22p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6320013 GenBank EIW11546.1 377 Pph22p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:6320013 GenBank EWG91623.1 377 Pph22p [Saccharomyces cerevisiae P301]
GI:6320013 GenBank EWG96825.1 377 Pph22p [Saccharomyces cerevisiae R103]
GI:6320013 gnl McCuskerlabDuke 377 Pph22p [Saccharomyces cerevisiae YJM993]

Related Sequences to LMP007232 proteins

Reference Database Accession Length Protein Name
GI:6320013 GenBank EGA59525.1 377 Pph22p [Saccharomyces cerevisiae FostersB]
GI:6320013 GenBank EHM99660.1 377 Pph22p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6320013 GenBank EHN03397.1 369 Pph21p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6320013 GenBank EJS44458.1 377 pph22p [Saccharomyces arboricola H-6]
GI:6320013 GenBank EJT43829.1 377 PPH22-like protein [Saccharomyces kudriavzevii IFO 1802]
GI:6320013 GenBank EJT44608.1 369 PPH21-like protein [Saccharomyces kudriavzevii IFO 1802]