Gene/Proteome Database (LMPD)
Proteins
| Gpi12p | |
|---|---|
| Refseq ID | NP_014008 |
| Protein GI | 6323937 |
| UniProt ID | P23797 |
| mRNA ID | NM_001182788 |
| Length | 304 |
| MKMLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYTY | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | ISS:SGD | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0000225 | ISS:SGD | F | N-acetylglucosaminylphosphatidylinositol deacetylase activity |
| GO:0006506 | ISS:SGD | P | GPI anchor biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00065 | GPI-anchor biosynthesis, core oligosaccharide |
| sce_M00065 | GPI-anchor biosynthesis, core oligosaccharide |
| ko00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| sce00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| sce01100 | Metabolic pathways |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol + H(2)O = 6-(alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol + acetate. |
| Function | Involved in the second step of GPI biosynthesis. De-N- acetylation of N-acetylglucosaminyl-phosphatidylinositol. |
| Interaction | P23255:TAF2; NbExp=1; IntAct=EBI-7773, EBI-18862; |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
| Sequence Caution | Sequence=M59860; Type=Frameshift; Positions=64; Evidence= ; |
| Sequence Caution | Sequence=M59860; Type=Frameshift; Positions=64; Evidence={ECO:0000305}; |
| Similarity | Belongs to the PIGL family |
| Similarity | Belongs to the PIGL family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007228 (as displayed in Record Overview)
Identical Sequences to LMP007228 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007228 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|