Gene/Proteome Database (LMPD)
Proteins
| Nsg2p | |
|---|---|
| Refseq ID | NP_014243 |
| Protein GI | 398364569 |
| UniProt ID | P53898 |
| mRNA ID | NM_001182994 |
| Length | 299 |
| MANRGEPDPKKSTESICSLTKPQLYSLYDDDVVRSEDNEIYEELKRSVSIDSTKYSRDQTIDSTFYLAHKVGGSLPRNTVSSNNLERILSASSIHENFPSRTRQTRQNILHYLQAVLILSLSGFAYHELSRNLHDNHLLHPDFASRPLLLGVKLCNWLSNGVLPNWLGYGVEGLLFGSVVPILDNIFQTEVVKSSVHHDSLTSVIRSINAMLGVTFGIRKIQWNSSLQAAGAWGLLNIILWLFFDGSISMLMSCICIGVGCCISCYKDIIDGSQFLYFMDFYFLGSLMFGKLGRYLYSH | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0051082 | IMP:SGD | F | unfolded protein binding |
| GO:0016126 | IGI:SGD | P | sterol biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR025929 | Insulin-induced protein family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Stabilizes the HMG-CoA reductase HMG2 by preventing its HRD1-dependent degradation. Binds directly to the sterol-sensing domain (SSD)-containing transmembrane region of HMG2, promoting its folding to protect it from degradation |
| Function | Stabilizes the HMG-CoA reductase HMG2 by preventing its HRD1-dependent degradation. Binds directly to the sterol-sensing domain (SSD)-containing transmembrane region of HMG2, promoting its folding to protect it from degradation. {ECO:0000269|PubMed:16270032}. |
| Miscellaneous | Present with 3390 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 3390 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | To yeast YHR133c |
| Similarity | To yeast YHR133c. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi- pass membrane protein {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:16270032}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:16270032}; Multi- pass membrane protein {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:16270032}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007227 (as displayed in Record Overview)
Identical Sequences to LMP007227 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007227 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|