Gene/Proteome Database (LMPD)

LMPD ID
LMP007210
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
putative N,N-dimethylaniline monooxygenase COQ6
Gene Symbol
Synonyms
-
Alternate Names
putative N,N-dimethylaniline monooxygenase COQ6
Chromosome
VII
EC Number
1.14.13.-

Proteins

putative N,N-dimethylaniline monooxygenase COQ6
Refseq ID NP_011771
Protein GI 6321694
UniProt ID P53318
mRNA ID NM_001181384
Length 479
RefSeq Status PROVISIONAL
MFFSKVMLTRRILVRGLATAKSSAPKLTDVLIVGGGPAGLTLAASIKNSPQLKDLKTTLVDMVDLKDKLSDFYNSPPDYFTNRIVSVTPRSIHFLENNAGATLMHDRIQSYDGLYVTDGCSKATLDLARDSMLCMIEIINIQASLYNRISQYDSKKDSIDIIDNTKVVNIKHSDPNDPLSWPLVTLSNGEVYKTRLLVGADGFNSPTRRFSQIPSRGWMYNAYGVVASMKLEYPPFKLRGWQRFLPTGPIAHLPMPENNATLVWSSSERLSRLLLSLPPESFTALINAAFVLEDADMNYYYRTLEDGSMDTDKLIEDIKFRTEEIYATLKDESDIDEIYPPRVVSIIDKTRARFPLKLTHADRYCTDRVALVGDAAHTTHPLAGQGLNMGQTDVHGLVYALEKAMERGLDIGSSLSLEPFWAERYPSNNVLLGMADKLFKLYHTNFPPVVALRTFGLNLTNKIGPVKNMIIDTLGGNEK

Gene Information

Entrez Gene ID
Gene Name
putative N,N-dimethylaniline monooxygenase COQ6
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005743 IDA:SGD C mitochondrial inner membrane
GO:0004499 ISA:SGD F N,N-dimethylaniline monooxygenase activity
GO:0050660 IEA:InterPro F flavin adenine dinucleotide binding
GO:0016709 TAS:Reactome F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0006744 IMP:SGD P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
sce00130 Ubiquinone and other terpenoid-quinone biosynthesis
sce_M00128 Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-7230 ubiquinol-6 biosynthesis from 4-aminobenzoate

Domain Information

InterPro Annotations

Accession Description
IPR003042 Aromatic-ring hydroxylase-like
IPR002938 Monooxygenase, FAD-binding
IPR010971 Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/UbiI/COQ6
IPR018168 Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6, conserved site
IPR000689 Ubiquinone biosynthesis monooxygenase, COQ6-type

UniProt Annotations

Entry Information

Gene Name
putative N,N-dimethylaniline monooxygenase COQ6
Protein Entry
COQ6_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Cofactor Name=FAD; Xref=ChEBI:CHEBI:57692; Evidence={ECO:0000305};
Miscellaneous Present with 2940 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Sequence Caution Sequence=CAA56705.1; Type=Frameshift; Positions=212, 434; Evidence={ECO:0000305};
Similarity Belongs to the UbiH/COQ6 family. {ECO:0000305}.
Subcellular Location Mitochondrion inner membrane {ECO:0000269|PubMed:12721307}; Peripheral membrane protein {ECO:0000269|PubMed:12721307}; Matrix side {ECO:0000269|PubMed:12721307}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007210 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6321694 RefSeq NP_011771 479 putative N,N-dimethylaniline monooxygenase COQ6

Identical Sequences to LMP007210 proteins

Reference Database Accession Length Protein Name
GI:6321694 EMBL CBN59415.1 479 unnamed protein product [Saccharomyces cerevisiae]
GI:6321694 GenBank EIW10605.1 479 Coq6p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:6321694 GenBank EWG91191.1 479 Coq6p [Saccharomyces cerevisiae P301]
GI:6321694 GenBank EWG95754.1 479 Coq6p [Saccharomyces cerevisiae R103]
GI:6321694 GenBank EWH18477.1 479 Coq6p [Saccharomyces cerevisiae P283]
GI:6321694 gnl McCuskerlabDuke 479 Coq6p [Saccharomyces cerevisiae YJM993]

Related Sequences to LMP007210 proteins

Reference Database Accession Length Protein Name
GI:6321694 DBBJ GAA23624.1 479 K7_Coq6p [Saccharomyces cerevisiae Kyokai no. 7]
GI:6321694 GenBank EDN61840.1 479 monooxygenase [Saccharomyces cerevisiae YJM789]
GI:6321694 GenBank EGA58516.1 479 Coq6p [Saccharomyces cerevisiae FostersB]
GI:6321694 GenBank EGA62160.1 479 Coq6p [Saccharomyces cerevisiae FostersO]
GI:6321694 GenBank EGA74800.1 479 Coq6p [Saccharomyces cerevisiae AWRI796]
GI:6321694 GenBank EWG86116.1 479 Coq6p [Saccharomyces cerevisiae R008]