Gene/Proteome Database (LMPD)
Proteins
| Erg28p | |
|---|---|
| Refseq ID | NP_010962 |
| Protein GI | 6320883 |
| UniProt ID | P40030 |
| mRNA ID | NM_001178935 |
| Length | 148 |
| RefSeq Status | PROVISIONAL |
| MFSLQDVITTTKTTLAAMPKGYLPKWLLFISIVSVFNSIQTYVSGLELTRKVYERKPTETTHLSARTFGTWTFISCVIRFYGAMYLNEPHIFELVFMSYMVALFHFGSELLIFRTCKLGKGFMGPLVVSTTSLVWMYKQREYYTGVAW | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | IDA:SGD | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0030674 | IPI:SGD | F | protein binding, bridging |
| GO:0006696 | IDA:SGD | P | ergosterol biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005352 | Erg28 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Has a role as a scaffold to help anchor ERG25, ERG26 and ERG27 to the endoplasmic reticulum. May also be responsible for facilitating their interaction. {ECO:0000269|PubMed:11160377}. |
| Interaction | P53045:ERG25; NbExp=3; IntAct=EBI-22518, EBI-6506; P53199:ERG26; NbExp=3; IntAct=EBI-22518, EBI-6514; Q12452:ERG27; NbExp=6; IntAct=EBI-22518, EBI-38132; |
| Miscellaneous | Present with 377 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the ERG28 family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305|PubMed:12119386}; Multi-pass membrane protein {ECO:0000305|PubMed:12119386}. |
| Subunit | Heterotetramer of ERG25, ERG26, ERG27 and ERG28. ERG28 acts as a scaffold to tether ERG27 and other 4,4-demethylation- related enzymes, forming a demethylation enzyme complex, in the endoplasmic reticulum. Interacts with ERG25, ERG26 and ERG27. Also interacts with ERG1, ERG3, ERG5, ERG6 and ERG11. {ECO:0000269|PubMed:12119386, ECO:0000269|PubMed:15522820, ECO:0000269|PubMed:15995173}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007207 (as displayed in Record Overview)
Identical Sequences to LMP007207 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6320883 | GenBank | EIW10827.1 | 148 | Erg28p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6320883 | GenBank | EWG86533.1 | 148 | Erg28p [Saccharomyces cerevisiae R008] |
| GI:6320883 | GenBank | EWG91431.1 | 148 | Erg28p [Saccharomyces cerevisiae P301] |
| GI:6320883 | GenBank | EWG96454.1 | 148 | Erg28p [Saccharomyces cerevisiae R103] |
| GI:6320883 | GenBank | EWH18797.1 | 148 | Erg28p [Saccharomyces cerevisiae P283] |
| GI:6320883 | gnl | McCuskerlabDuke | 148 | Erg28p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP007207 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6320883 | EMBL | CCE94099.1 | 148 | hypothetical protein TDEL_0H02400 [Torulaspora delbrueckii] |
| GI:6320883 | GenBank | EHN02717.1 | 148 | Erg28p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7] |
| GI:6320883 | GenBank | EJS44057.1 | 148 | erg28p [Saccharomyces arboricola H-6] |
| GI:6320883 | GenBank | EJT44952.1 | 148 | ERG28-like protein [Saccharomyces kudriavzevii IFO 1802] |
| GI:6320883 | RefSeq | XP_002551608.1 | 148 | KLTH0A03454p [Lachancea thermotolerans CBS 6340] |
| GI:6320883 | RefSeq | XP_003683310.1 | 148 | hypothetical protein TDEL_0H02400 [Torulaspora delbrueckii] |