Gene/Proteome Database (LMPD)

LMPD ID
LMP007193
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
ethanolamine-phosphate cytidylyltransferase
Gene Symbol
Synonyms
MUQ1
Alternate Names
ethanolamine-phosphate cytidylyltransferase
Chromosome
VII
EC Number
2.7.7.14

Proteins

ethanolamine-phosphate cytidylyltransferase
Refseq ID NP_011521
Protein GI 6321444
UniProt ID P33412
mRNA ID NM_001181136
Length 323
RefSeq Status PROVISIONAL
MTVNLDPDKVWIDGCFDFTHHGHAGAILQARRTVSKENGKLFCGVHTDEDIQHNKGTPVMNSSERYEHTRSNRWCSEVVEAAPYVTDPNWMDKYQCQYVVHGDDITIDANGEDCYKLVKEMGRFKVVKRTYGVSTTEIIHRILTKKSLPPTHPDYYPTTQELSFYSVAQDAVSKHCYVFQRDLDNVLVNGGYKFDAEDCVYVDGDFDLFHMGDIDQLRKLKMDLHPDKKLIVGITTSDYSSTIMTMKERVLSVLSCKYVDAVIIDADATSMSQYNCEKYHIGTAVLTAAGKFSEYLTKELIVKRVESQREVYIARNQKKGMSI

Gene Information

Entrez Gene ID
Gene Name
ethanolamine-phosphate cytidylyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0004306 IDA:SGD F ethanolamine-phosphate cytidylyltransferase activity
GO:0006646 IMP:SGD P phosphatidylethanolamine biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
sce00564 Glycerophospholipid metabolism
sce01100 Metabolic pathways
sce_M00092 Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE

REACTOME Pathway Links

REACTOME Pathway ID Description
5618597 Synthesis of PE

Domain Information

InterPro Annotations

Accession Description
IPR004821 Cytidyltransferase-like domain
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold

UniProt Annotations

Entry Information

Gene Name
ethanolamine-phosphate cytidylyltransferase
Protein Entry
ECT1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity CTP + ethanolamine phosphate = diphosphate + CDP-ethanolamine.
Function Ethanolamine-phosphate cytidylyltransferase which catalyzes the second step of phosphatidylethanolamine biosynthesis. Involved in the maintenance of plasma membrane and required for proper sporulation. {ECO:0000269|PubMed:17761681, ECO:0000269|PubMed:18776695}.
Induction By isooctane. {ECO:0000269|PubMed:11055939}.
Miscellaneous Present with 4700 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from ethanolamine: step 2/3.
Similarity Belongs to the cytidylyltransferase family. {ECO:0000305}.
Subcellular Location Cytoplasm {ECO:0000269|PubMed:14562095}. Nucleus {ECO:0000269|PubMed:14562095}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007193 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6321444 RefSeq NP_011521 323 ethanolamine-phosphate cytidylyltransferase

Identical Sequences to LMP007193 proteins

Reference Database Accession Length Protein Name
GI:6321444 EMBL CBF65894.1 323 unnamed protein product [Saccharomyces cerevisiae]
GI:6321444 EMBL CBU90765.1 323 unnamed protein product [Saccharomyces cerevisiae]
GI:6321444 GenBank ABZ48020.1 323 Sequence 21958 from patent US 7314974
GI:6321444 GenBank EIW10360.1 323 Ect1p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:6321444 GenBank AGX57857.1 323 Sequence 16015 from patent US 8541208
GI:6321444 Third Party Genbank DAA08105.1 323 TPA: ethanolamine-phosphate cytidylyltransferase [Saccharomyces cerevisiae S288c]

Related Sequences to LMP007193 proteins

Reference Database Accession Length Protein Name
GI:6321444 DBBJ BAA09310.1 323 CTP: phosphoethanolamine cytidylyltransferase [Saccharomyces cerevisiae]
GI:6321444 GenBank EGA74864.1 323 Muq1p [Saccharomyces cerevisiae AWRI796]
GI:6321444 GenBank EGA78902.1 323 Muq1p [Saccharomyces cerevisiae Vin13]
GI:6321444 GenBank EGA82801.1 323 Muq1p [Saccharomyces cerevisiae Lalvin QA23]
GI:6321444 GenBank EGA86811.1 323 Muq1p [Saccharomyces cerevisiae VL3]
GI:6321444 gnl McCuskerlabDuke 323 Ect1p [Saccharomyces cerevisiae YJM993]