LIPID MAPS

LMPD ID

LMP007149

Gene ID

Species

Saccharomyces cerevisiae S288c (Yeast (S288c))

Gene Name

Cyb5p

Gene Symbol

CYB5

Synonyms

-

Chromosome

XIV

Cyb5p
Refseq ID	NP_014288
Protein GI	398364811
UniProt ID	P40312
mRNA ID	NM_001182949
Length	120
MPKVYSYQEVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIGHSDEALRLLKGLYIGDVDKTSERVSVEKVSTSENQSKGSGTLVVILAILMLGVAYYLLNE

Entrez Gene ID

Gene Name

Cyb5p

Gene Symbol

CYB5

Species

Saccharomyces cerevisiae S288c

GO ID	Source	Type	Description
GO:0005789	IDA:SGD	C	endoplasmic reticulum membrane
GO:0016021	IEA:UniProtKB-KW	C	integral component of membrane
GO:0009055	IDA:SGD	F	electron carrier activity
GO:0020037	IEA:InterPro	F	heme binding
GO:0046872	IEA:UniProtKB-KW	F	metal ion binding
GO:0055114	IEA:UniProtKB-KW	P	oxidation-reduction process
GO:0016126	IDA:SGD	P	sterol biosynthetic process

REACTOME Pathway ID	Description
5618374	Defective AMN causes hereditary megaloblastic anemia 1
5618384	Defective BTD causes biotidinase deficiency
5618383	Defective CD320 causes methylmalonic aciduria
5618375	Defective CUBN causes hereditary megaloblastic anemia 1
5618372	Defective GIF causes intrinsic factor deficiency
5618386	Defective HLCS causes multiple carboxylase deficiency
5618373	Defective LMBRD1 causes methylmalonic aciduria and homocystinuria type cblF
5618381	Defective MMAA causes methylmalonic aciduria type cblA
5618378	Defective MMAB causes methylmalonic aciduria type cblB
5618380	Defective MMACHC causes methylmalonic aciduria and homocystinuria type cblC
5618379	Defective MMADHC causes methylmalonic aciduria and homocystinuria type cblD
5618377	Defective MTR causes methylmalonic aciduria and homocystinuria type cblG
5618376	Defective MTRR causes methylmalonic aciduria and homocystinuria type cblE
5618382	Defective MUT causes methylmalonic aciduria mut type
5618369	Defective TCN2 causes hereditary megaloblastic anemia
5618385	Defects in biotin (Btn) metabolism
5618370	Defects in cobalamin (B12) metabolism
5618371	Defects in vitamin and cofactor metabolism
5618026	Disease
5618023	Metabolism
5618368	Metabolism of vitamins and cofactors
5618367	Metabolism of water-soluble vitamins and cofactors
5618414	Vitamin C (ascorbate) metabolism

Accession	Description
IPR018506	Cytochrome b5, heme-binding site
IPR001199	Cytochrome b5-like heme/steroid binding domain

Gene Name

Cyb5p

Protein Entry

CYB5_YEAST

UniProt ID

Species

Yeast (S288c)

Comment Type	Description
Function	Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. It plays a role in fatty-acid desaturation and is also involved in several steps of the sterol biosynthesis pathway, particularly in the 4- demethylation of the 4,4'-dimethyl zymosterol.
Miscellaneous	Present with 5390 molecules/cell in log phase SD medium
Miscellaneous	Present with 5390 molecules/cell in log phase SD medium. {ECO:0000269\|PubMed:14562106}.
Similarity	Belongs to the cytochrome b5 family
Similarity	Belongs to the cytochrome b5 family. {ECO:0000305}.
Similarity	Contains 1 cytochrome b5 heme-binding domain
Similarity	Contains 1 cytochrome b5 heme-binding domain. {ECO:0000255\|PROSITE-ProRule:PRU00279}.
Subcellular Location	Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein ; Cytoplasmic side {ECO:0000250}. Microsome membrane ; Single-pass membrane protein ; Cytoplasmic side .
Subcellular Location	Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}. Microsome membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}.